Annotation Detail for CDH2
Basic Information Top
| Gene Symbol: | CDH2 ( CD325,CDHN,CDw325,NCAD ) |
|---|---|
| Gene Full Name: | cadherin 2, type 1, N-cadherin (neuronal) |
| Band: | 18q12.1 |
| Quick Links | Entrez ID:1000; OMIM: 114020; Uniprot ID:CADH2_HUMAN; ENSEMBL ID: ENSG00000170558; HGNC ID: 1759 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.464829
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 20 / 70761 | 282 | |
| blastocyst | 11 / 62319 | 176 | |
| fetus | 47 / 564012 | 83 | |
| neonate | 0 / 31097 | 0 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 69 / 1939121 | 35 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 2 / 12794 | 156 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 0 / 94178 | 0 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 4 / 82823 | 48 | |
| colorectal tumor | 2 / 114246 | 17 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 1 / 119369 | 8 | |
| germ cell tumor | 17 / 263845 | 64 | |
| glioma | 6 / 106883 | 56 | |
| head and neck tumor | 4 / 136302 | 29 | |
| kidney tumor | 3 / 68959 | 43 | |
| leukemia | 0 / 95842 | 0 | |
| liver tumor | 7 / 96359 | 72 | |
| lung tumor | 0 / 103127 | 0 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 2 / 97250 | 20 | |
| normal | 187 / 3360307 | 55 | |
| ovarian tumor | 1 / 76682 | 13 | |
| pancreatic tumor | 0 / 104616 | 0 | |
| primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | |
| prostate cancer | 3 / 102680 | 29 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 1 / 124949 | 8 | |
| soft tissue/muscle tissue tumor | 9 / 125191 | 71 | |
| uterine tumor | 0 / 90257 | 0 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 5 / 33197 | 150 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 0 / 29757 | 0 | |
| blood | 0 / 123478 | 0 | |
| bone | 3 / 71655 | 41 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 83 / 1100989 | 75 | |
| cervix | 0 / 48171 | 0 | |
| connective tissue | 13 / 149255 | 87 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 38 / 215722 | 176 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 6 / 211054 | 28 | |
| heart | 11 / 89626 | 122 | |
| intestine | 3 / 234472 | 12 | |
| kidney | 12 / 211777 | 56 | |
| larynx | 0 / 24145 | 0 | |
| liver | 9 / 207743 | 43 | |
| lung | 2 / 336974 | 5 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 0 / 153271 | 0 | |
| mouth | 0 / 67052 | 0 | |
| muscle | 2 / 107715 | 18 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 3 / 102051 | 29 | |
| pancreas | 3 / 214812 | 13 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 0 / 280825 | 0 | |
| prostate | 4 / 189345 | 21 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 6 / 210574 | 28 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 0 / 96619 | 0 | |
| testis | 50 / 330442 | 151 | |
| thymus | 1 / 81131 | 12 | |
| thyroid | 4 / 47473 | 84 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 0 / 232878 | 0 | |
| vascular | 12 / 51780 | 231 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 203440_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 12.8 | |
| Adipocyte | 32.5 | |
| AdrenalCortex | 72.75 | |
| Adrenalgland | 79.85 | |
| Amygdala | 149.5 | |
| Appendix | 28.5 | |
| AtrioventricularNode | 24.05 | |
| BDCA4+_DentriticCells | 11.9 | |
| Bonemarrow | 29.15 | |
| BronchialEpithelialCells | 14.55 | |
| CD105+_Endothelial | 14.7 | |
| CD14+_Monocytes | 18.95 | |
| CD19+_BCells(neg._sel.) | 14.4 | |
| CD33+_Myeloid | 16.85 | |
| CD34+ | 33.55 | |
| CD4+_Tcells | 16 | |
| CD56+_NKCells | 15.35 | |
| CD71+_EarlyErythroid | 14.3 | |
| CD8+_Tcells | 11.2 | |
| CardiacMyocytes | 433.05 | |
| Caudatenucleus | 42.35 | |
| Cerebellum | 43.25 | |
| CerebellumPeduncles | 48.2 | |
| CiliaryGanglion | 21.45 | |
| CingulateCortex | 72.3 | |
| Colorectaladenocarcinoma | 16.8 | |
| DorsalRootGanglion | 23.05 | |
| FetalThyroid | 29.45 | |
| Fetalbrain | 213.05 | |
| Fetalliver | 93.55 | |
| Fetallung | 18.55 | |
| GlobusPallidus | 26.25 | |
| Heart | 106.95 | |
| Hypothalamus | 97.8 | |
| Kidney | 24.8 | |
| Leukemia_chronicMyelogenousK-562 | 19.45 | |
| Leukemia_promyelocytic-HL-60 | 14.8 | |
| Leukemialymphoblastic(MOLT-4) | 33.35 | |
| Liver | 44.35 | |
| Lung | 26.95 | |
| Lymphnode | 24.05 | |
| Lymphoma_burkitts(Daudi) | 28.25 | |
| Lymphoma_burkitts(Raji) | 34.3 | |
| MedullaOblongata | 38.9 | |
| OccipitalLobe | 56.55 | |
| OlfactoryBulb | 22.6 | |
| Ovary | 18.85 | |
| Pancreas | 18.9 | |
| PancreaticIslet | 28.4 | |
| ParietalLobe | 69.6 | |
| Pituitary | 55.1 | |
| Placenta | 14 | |
| Pons | 33.55 | |
| PrefrontalCortex | 287.95 | |
| Prostate | 27.2 | |
| Salivarygland | 13.45 | |
| SkeletalMuscle | 35.7 | |
| Skin | 21.4 | |
| SmoothMuscle | 701.55 | |
| Spinalcord | 66.6 | |
| SubthalamicNucleus | 43.7 | |
| SuperiorCervicalGanglion | 36.5 | |
| TemporalLobe | 44.1 | |
| Testis | 84.75 | |
| TestisGermCell | 60.2 | |
| TestisIntersitial | 42.25 | |
| TestisLeydigCell | 35.2 | |
| TestisSeminiferousTubule | 78.7 | |
| Thalamus | 73.4 | |
| Thymus | 17.05 | |
| Thyroid | 26 | |
| Tongue | 22.8 | |
| Tonsil | 27.95 | |
| Trachea | 23.65 | |
| TrigeminalGanglion | 33.35 | |
| Uterus | 22.2 | |
| UterusCorpus | 25.4 | |
| WholeBlood | 15.65 | |
| Wholebrain | 44.1 | |
| colon | 15.95 | |
| pineal_day | 43.54 | |
| pineal_night | 37.4 | |
| retina | 48.775 | |
| small_intestine | 18.15 |
- Probe name: CUST_15278_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 7.18 ± 0.23 | |
| Basal Forebrain | 6.81 ± 0.19 | |
| Basal Part of Pons | 6.62 ± 0.28 | |
| Cerebellar Cortex | 6.95 ± 0.25 | |
| Cerebellar Nuclei | 6.57 ± 0.41 | |
| Claustrum | 7.27 ± 0.29 | |
| Epithalamus | 7.04 ± 0.45 | |
| Frontal Lobe | 6.72 ± 0.28 | |
| Globus Pallidus | 6.77 ± 0.17 | |
| Hypothalamus | 6.58 ± 0.48 | |
| Insula | 6.93 ± 0.19 | |
| Limbic Lobe | 6.95 ± 0.35 | |
| Mesencephalon | 6.75 ± 0.34 | |
| Myelencephalon | 6.81 ± 0.39 | |
| Occipital Lobe | 7.25 ± 0.39 | |
| Parietal Lobe | 6.87 ± 0.28 | |
| Pontine Tegmentum | 6.92 ± 0.33 | |
| Striatum | 6.3 ± 0.33 | |
| Subthalamus | 5.92 ± 0.34 | |
| Temporal Lobe | 6.85 ± 0.26 | |
| Thalamus | 6.87 ± 0.32 | |
| White Matter | 6.25 ± 0.28 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Cdh2 | CB | Cerebellum | 22.01 | |
| 41.2 | ||||
| Cdh2 | CTX | Cerebral cortex | 21.87 | |
| 16.82 | ||||
| Cdh2 | HIP | Hippocampal region | 60.6 | |
| 50.58 | ||||
| Cdh2 | HPF | Hippocampal formation | 56.96 | |
| 49.85 | ||||
| Cdh2 | HY | Hypothalamus | 28.87 | |
| 21.14 | ||||
| Cdh2 | LSX | Lateral septal complex | 16.64 | |
| 12.17 | ||||
| Cdh2 | MB | Midbrain | 15 | |
| 13.24 | ||||
| Cdh2 | MY | Medulla | 15.65 | |
| 16.74 | ||||
| Cdh2 | OLF | Olfactory bulb | 47.6 | |
| 33.48 | ||||
| Cdh2 | P | Pons | 13.11 | |
| 12.25 | ||||
| Cdh2 | PAL | Pallidum | 17.01 | |
| 15.15 | ||||
| Cdh2 | RHP | Retrohippocampal region | 53.67 | |
| 49.84 | ||||
| Cdh2 | sAMY | Striatum-like amygdalar nuclei | 31.25 | |
| 22.67 | ||||
| Cdh2 | STR | Striatum | 9.86 | |
| 7.13 | ||||
| Cdh2 | STRd | Striatum dorsal region | 2.56 | |
| 2.19 | ||||
| Cdh2 | STRv | Striatum ventral region | 18.09 | |
| 10.84 | ||||
| Cdh2 | TH | Thalamus | 30.08 | |
| 28.93 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| CADH2_HUMAN_506 | 21 | 506 | 526 | QEEGLHAGTMLTTFTAQDPDR | PRIDE |
| CADH2_HUMAN_527 | 7 | 527 | 533 | YMQQNIR | PRIDE |
| CADH2_HUMAN_757 | 11 | 757 | 767 | QLLIDPEDDVR | PRIDE |
| PAp00043288 | 35 | 773 | 807 | YDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIR | Peptide Atlas |



