Annotation Detail for ARPC5
Basic Information Top
Gene Symbol: | ARPC5 ( ARC16,MGC88523,dJ127C7.3,p16-Arc ) |
---|---|
Gene Full Name: | actin related protein 2/3 complex, subunit 5, 16kDa |
Band: | 1q25.3 |
Quick Links | Entrez ID:10092; OMIM: 604227; Uniprot ID:ARPC5_HUMAN; ENSEMBL ID: ENSG00000162704; HGNC ID: 708 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.518609
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 27 / 70761 | 381 | |
blastocyst | 7 / 62319 | 112 | |
fetus | 103 / 564012 | 182 | |
neonate | 19 / 31097 | 610 | |
infant | 12 / 23620 | 508 | |
juvenile | 17 / 55556 | 305 | |
adult | 335 / 1939121 | 172 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 5 / 12794 | 390 | |
bladder carcinoma | 9 / 17475 | 515 | |
breast (mammary gland) tumor | 9 / 94178 | 95 | |
cervical tumor | 8 / 34366 | 232 | |
chondrosarcoma | 16 / 82823 | 193 | |
colorectal tumor | 9 / 114246 | 78 | |
esophageal tumor | 14 / 17290 | 809 | |
gastrointestinal tumor | 30 / 119369 | 251 | |
germ cell tumor | 87 / 263845 | 329 | |
glioma | 18 / 106883 | 168 | |
head and neck tumor | 13 / 136302 | 95 | |
kidney tumor | 13 / 68959 | 188 | |
leukemia | 25 / 95842 | 260 | |
liver tumor | 23 / 96359 | 238 | |
lung tumor | 14 / 103127 | 135 | |
lymphoma | 20 / 71755 | 278 | |
non-neoplasia | 37 / 97250 | 380 | |
normal | 783 / 3360307 | 233 | |
ovarian tumor | 10 / 76682 | 130 | |
pancreatic tumor | 14 / 104616 | 133 | |
primitive neuroectodermal tumor of the CNS | 33 / 125680 | 262 | |
prostate cancer | 11 / 102680 | 107 | |
retinoblastoma | 6 / 46356 | 129 | |
skin tumor | 22 / 124949 | 176 | |
soft tissue/muscle tissue tumor | 11 / 125191 | 87 | |
uterine tumor | 20 / 90257 | 221 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 2 / 13106 | 152 | |
adrenal gland | 12 / 33197 | 361 | |
ascites | 17 / 40015 | 424 | |
bladder | 13 / 29757 | 436 | |
blood | 55 / 123478 | 445 | |
bone | 18 / 71655 | 251 | |
bone marrow | 10 / 48801 | 204 | |
brain | 237 / 1100989 | 215 | |
cervix | 13 / 48171 | 269 | |
connective tissue | 44 / 149255 | 294 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 54 / 215722 | 250 | |
esophagus | 14 / 20209 | 692 | |
eye | 25 / 211054 | 118 | |
heart | 20 / 89626 | 223 | |
intestine | 63 / 234472 | 268 | |
kidney | 37 / 211777 | 174 | |
larynx | 1 / 24145 | 41 | |
liver | 34 / 207743 | 163 | |
lung | 56 / 336974 | 166 | |
lymph | 10 / 44270 | 225 | |
lymph node | 13 / 91610 | 141 | |
mammary gland | 12 / 153271 | 78 | |
mouth | 7 / 67052 | 104 | |
muscle | 2 / 107715 | 18 | |
nerve | 3 / 15768 | 190 | |
ovary | 21 / 102051 | 205 | |
pancreas | 21 / 214812 | 97 | |
parathyroid | 2 / 20539 | 97 | |
pharynx | 4 / 41328 | 96 | |
pituitary gland | 2 / 16585 | 120 | |
placenta | 90 / 280825 | 320 | |
prostate | 20 / 189345 | 105 | |
salivary gland | 3 / 20155 | 148 | |
skin | 32 / 210574 | 151 | |
spleen | 26 / 53952 | 481 | |
stomach | 18 / 96619 | 186 | |
testis | 61 / 330442 | 184 | |
thymus | 28 / 81131 | 345 | |
thyroid | 7 / 47473 | 147 | |
tonsil | 1 / 16999 | 58 | |
trachea | 5 / 52413 | 95 | |
umbilical cord | 12 / 13680 | 877 | |
uterus | 72 / 232878 | 309 | |
vascular | 43 / 51780 | 830 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 211963_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 1923.6 | |
Adipocyte | 259.85 | |
AdrenalCortex | 67.75 | |
Adrenalgland | 99.3 | |
Amygdala | 281.55 | |
Appendix | 107.45 | |
AtrioventricularNode | 71.05 | |
BDCA4+_DentriticCells | 1528.55 | |
Bonemarrow | 570.1 | |
BronchialEpithelialCells | 813.85 | |
CD105+_Endothelial | 239.65 | |
CD14+_Monocytes | 1589 | |
CD19+_BCells(neg._sel.) | 683.45 | |
CD33+_Myeloid | 2051 | |
CD34+ | 808.9 | |
CD4+_Tcells | 813 | |
CD56+_NKCells | 1642.45 | |
CD71+_EarlyErythroid | 200.15 | |
CD8+_Tcells | 888.3 | |
CardiacMyocytes | 611.25 | |
Caudatenucleus | 113.7 | |
Cerebellum | 49.85 | |
CerebellumPeduncles | 89.4 | |
CiliaryGanglion | 58.05 | |
CingulateCortex | 91.4 | |
Colorectaladenocarcinoma | 124.35 | |
DorsalRootGanglion | 97.65 | |
FetalThyroid | 133 | |
Fetalbrain | 413.55 | |
Fetalliver | 115.1 | |
Fetallung | 356.7 | |
GlobusPallidus | 47.45 | |
Heart | 53.5 | |
Hypothalamus | 211.85 | |
Kidney | 46.85 | |
Leukemia_chronicMyelogenousK-562 | 125.3 | |
Leukemia_promyelocytic-HL-60 | 275 | |
Leukemialymphoblastic(MOLT-4) | 329.2 | |
Liver | 73.5 | |
Lung | 431.2 | |
Lymphnode | 396.9 | |
Lymphoma_burkitts(Daudi) | 343.9 | |
Lymphoma_burkitts(Raji) | 161 | |
MedullaOblongata | 129.65 | |
OccipitalLobe | 133.25 | |
OlfactoryBulb | 203.6 | |
Ovary | 78.35 | |
Pancreas | 98.15 | |
PancreaticIslet | 213 | |
ParietalLobe | 127 | |
Pituitary | 208.8 | |
Placenta | 924.8 | |
Pons | 98.3 | |
PrefrontalCortex | 162 | |
Prostate | 238.25 | |
Salivarygland | 97.1 | |
SkeletalMuscle | 78.85 | |
Skin | 62.8 | |
SmoothMuscle | 902.7 | |
Spinalcord | 376.7 | |
SubthalamicNucleus | 50.9 | |
SuperiorCervicalGanglion | 155.7 | |
TemporalLobe | 103.9 | |
Testis | 131.4 | |
TestisGermCell | 183 | |
TestisIntersitial | 95.65 | |
TestisLeydigCell | 98.3 | |
TestisSeminiferousTubule | 111.85 | |
Thalamus | 100.1 | |
Thymus | 449.65 | |
Thyroid | 256.35 | |
Tongue | 84.35 | |
Tonsil | 512 | |
Trachea | 131.3 | |
TrigeminalGanglion | 91.8 | |
Uterus | 295 | |
UterusCorpus | 105.4 | |
WholeBlood | 2516.35 | |
Wholebrain | 247.15 | |
colon | 487.1 | |
pineal_day | 174.02 | |
pineal_night | 159.48 | |
retina | 215.05 | |
small_intestine | 427.8 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: CUST_7785_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 9.84 ± 0.4 | |
Basal Forebrain | 9.8 ± 0.29 | |
Basal Part of Pons | 9.87 ± 0.23 | |
Cerebellar Cortex | 9.73 ± 0.19 | |
Cerebellar Nuclei | 10.05 ± 0.4 | |
Claustrum | 9.75 ± 0.38 | |
Epithalamus | 9.76 ± 0.37 | |
Frontal Lobe | 10.1 ± 0.32 | |
Globus Pallidus | 10.27 ± 0.24 | |
Hypothalamus | 10.11 ± 0.2 | |
Insula | 10.09 ± 0.26 | |
Limbic Lobe | 10.07 ± 0.49 | |
Mesencephalon | 9.79 ± 0.38 | |
Myelencephalon | 9.96 ± 0.4 | |
Occipital Lobe | 9.57 ± 0.36 | |
Parietal Lobe | 9.82 ± 0.32 | |
Pontine Tegmentum | 10.03 ± 0.35 | |
Striatum | 9.86 ± 0.26 | |
Subthalamus | 9.83 ± 0.29 | |
Temporal Lobe | 10.04 ± 0.33 | |
Thalamus | 9.85 ± 0.3 | |
White Matter | 11.46 ± 0.27 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Arpc5 | CB | Cerebellum | 3.64 | |
5.53 | ||||
Arpc5 | CTX | Cerebral cortex | 40.47 | |
32.6 | ||||
Arpc5 | HIP | Hippocampal region | 83.7 | |
100 | ||||
Arpc5 | HPF | Hippocampal formation | 69.72 | |
100 | ||||
Arpc5 | HY | Hypothalamus | 5.55 | |
5.23 | ||||
Arpc5 | LSX | Lateral septal complex | 46.53 | |
54.57 | ||||
Arpc5 | MB | Midbrain | 4.55 | |
4.42 | ||||
Arpc5 | MY | Medulla | 8.6 | |
9.38 | ||||
Arpc5 | OLF | Olfactory bulb | 28.3 | |
25.59 | ||||
Arpc5 | P | Pons | 6.03 | |
5.74 | ||||
Arpc5 | PAL | Pallidum | 4.36 | |
3.69 | ||||
Arpc5 | RHP | Retrohippocampal region | 49.83 | |
48.45 | ||||
Arpc5 | sAMY | Striatum-like amygdalar nuclei | 10.94 | |
8.14 | ||||
Arpc5 | STR | Striatum | 18.21 | |
14.83 | ||||
Arpc5 | STRd | Striatum dorsal region | 17.56 | |
12.79 | ||||
Arpc5 | STRv | Striatum ventral region | 9.71 | |
5.8 | ||||
Arpc5 | TH | Thalamus | 9.69 | |
9.54 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
ARPC5_HUMAN_0 | 0 | 0 | 0 | ALAAGGVGSIVR | PRIDE |
ARPC5_HUMAN_0 | 0 | 0 | 0 | QGNMTAALQAALK | PRIDE |
ARPC5_HUMAN_0 | 0 | 0 | 0 | QGNMTAALQAALKNPPINTK | PRIDE |
ARPC5_HUMAN_1 | 9 | 1 | 9 | SKNTVSSAR | PRIDE |
ARPC5_HUMAN_108 | 23 | 108 | 130 | YIYKGFESPSDNSSAMLLQWHEK | PRIDE |
ARPC5_HUMAN_112 | 19 | 112 | 130 | GFESPSDNSSAMLLQWHEK | PRIDE |
ARPC5_HUMAN_12 | 35 | 12 | 46 | KVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLR | PRIDE |
ARPC5_HUMAN_131 | 12 | 131 | 142 | ALAAGGVGSIVR | PRIDE |
ARPC5_HUMAN_2 | 9 | 2 | 10 | SKNTVSSAR | PRIDE |
ARPC5_HUMAN_47 | 13 | 47 | 59 | QGNMTAALQAALK | PRIDE |
ARPC5_HUMAN_47 | 20 | 47 | 66 | QGNMTAALQAALKNPPINTK | PRIDE |
ARPC5_HUMAN_81 | 12 | 81 | 92 | VLISFKANDIEK | PRIDE |
ARPC5_HUMAN_93 | 15 | 93 | 107 | AVQSLDKNGVDLLMK | PRIDE |
PAp00004608 | 18 | 13 | 30 | KVDVDEYDENKFVDEEDG | Peptide Atlas |