Annotation Detail for ACTR1B


Gene Symbol: | ACTR1B ( ARP1B,CTRN2,PC3 ) |
---|---|
Gene Full Name: | ARP1 actin-related protein 1 homolog B, centractin beta (yeast) |
Band: | 2q11.2 |
Quick Links | Entrez ID:10120; OMIM: 605144; Uniprot ID:ACTY_HUMAN; ENSEMBL ID: ENSG00000115073; HGNC ID: 168 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.98791
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 1 / 70761 | 14 | ![]() |
blastocyst | 3 / 62319 | 48 | ![]() |
fetus | 21 / 564012 | 37 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 5 / 55556 | 89 | ![]() |
adult | 140 / 1939121 | 72 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 15 / 94178 | 159 | ![]() |
cervical tumor | 5 / 34366 | 145 | ![]() |
chondrosarcoma | 8 / 82823 | 96 | ![]() |
colorectal tumor | 12 / 114246 | 105 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 9 / 119369 | 75 | ![]() |
germ cell tumor | 12 / 263845 | 45 | ![]() |
glioma | 16 / 106883 | 149 | ![]() |
head and neck tumor | 5 / 136302 | 36 | ![]() |
kidney tumor | 5 / 68959 | 72 | ![]() |
leukemia | 4 / 95842 | 41 | ![]() |
liver tumor | 2 / 96359 | 20 | ![]() |
lung tumor | 4 / 103127 | 38 | ![]() |
lymphoma | 9 / 71755 | 125 | ![]() |
non-neoplasia | 5 / 97250 | 51 | ![]() |
normal | 156 / 3360307 | 46 | ![]() |
ovarian tumor | 7 / 76682 | 91 | ![]() |
pancreatic tumor | 4 / 104616 | 38 | ![]() |
primitive neuroectodermal tumor of the CNS | 27 / 125680 | 214 | ![]() |
prostate cancer | 1 / 102680 | 9 | ![]() |
retinoblastoma | 8 / 46356 | 172 | ![]() |
skin tumor | 11 / 124949 | 88 | ![]() |
soft tissue/muscle tissue tumor | 6 / 125191 | 47 | ![]() |
uterine tumor | 4 / 90257 | 44 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 7 / 40015 | 174 | ![]() |
bladder | 0 / 29757 | 0 | |
blood | 7 / 123478 | 56 | ![]() |
bone | 8 / 71655 | 111 | ![]() |
bone marrow | 1 / 48801 | 20 | ![]() |
brain | 56 / 1100989 | 50 | ![]() |
cervix | 11 / 48171 | 228 | ![]() |
connective tissue | 5 / 149255 | 33 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 8 / 215722 | 37 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 30 / 211054 | 142 | ![]() |
heart | 10 / 89626 | 111 | ![]() |
intestine | 18 / 234472 | 76 | ![]() |
kidney | 13 / 211777 | 61 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 5 / 207743 | 24 | ![]() |
lung | 21 / 336974 | 62 | ![]() |
lymph | 5 / 44270 | 112 | ![]() |
lymph node | 2 / 91610 | 21 | ![]() |
mammary gland | 16 / 153271 | 104 | ![]() |
mouth | 0 / 67052 | 0 | |
muscle | 5 / 107715 | 46 | ![]() |
nerve | 3 / 15768 | 190 | ![]() |
ovary | 14 / 102051 | 137 | ![]() |
pancreas | 4 / 214812 | 18 | ![]() |
parathyroid | 2 / 20539 | 97 | ![]() |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 13 / 280825 | 46 | ![]() |
prostate | 8 / 189345 | 42 | ![]() |
salivary gland | 3 / 20155 | 148 | ![]() |
skin | 11 / 210574 | 52 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 3 / 96619 | 31 | ![]() |
testis | 2 / 330442 | 6 | ![]() |
thymus | 1 / 81131 | 12 | ![]() |
thyroid | 2 / 47473 | 42 | ![]() |
tonsil | 2 / 16999 | 117 | ![]() |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 8 / 232878 | 34 | ![]() |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202135_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 274.5 | ![]() |
Adipocyte | 76.6 | ![]() |
AdrenalCortex | 162.9 | ![]() |
Adrenalgland | 175.35 | ![]() |
Amygdala | 202.55 | ![]() |
Appendix | 70.2 | ![]() |
AtrioventricularNode | 45.95 | ![]() |
BDCA4+_DentriticCells | 160.8 | ![]() |
Bonemarrow | 111 | ![]() |
BronchialEpithelialCells | 73.9 | ![]() |
CD105+_Endothelial | 118.05 | ![]() |
CD14+_Monocytes | 161.05 | ![]() |
CD19+_BCells(neg._sel.) | 314.1 | ![]() |
CD33+_Myeloid | 191 | ![]() |
CD34+ | 205.55 | ![]() |
CD4+_Tcells | 337.35 | ![]() |
CD56+_NKCells | 264.15 | ![]() |
CD71+_EarlyErythroid | 44.25 | ![]() |
CD8+_Tcells | 296.15 | ![]() |
CardiacMyocytes | 113.35 | ![]() |
Caudatenucleus | 145.55 | ![]() |
Cerebellum | 166.75 | ![]() |
CerebellumPeduncles | 211.7 | ![]() |
CiliaryGanglion | 42.75 | ![]() |
CingulateCortex | 200.1 | ![]() |
Colorectaladenocarcinoma | 349.3 | ![]() |
DorsalRootGanglion | 67.6 | ![]() |
FetalThyroid | 137.1 | ![]() |
Fetalbrain | 123.1 | ![]() |
Fetalliver | 93.4 | ![]() |
Fetallung | 90.35 | ![]() |
GlobusPallidus | 133.9 | ![]() |
Heart | 292.8 | ![]() |
Hypothalamus | 183.7 | ![]() |
Kidney | 116.55 | ![]() |
Leukemia_chronicMyelogenousK-562 | 109.25 | ![]() |
Leukemia_promyelocytic-HL-60 | 130.35 | ![]() |
Leukemialymphoblastic(MOLT-4) | 263.55 | ![]() |
Liver | 256 | ![]() |
Lung | 185.7 | ![]() |
Lymphnode | 125.6 | ![]() |
Lymphoma_burkitts(Daudi) | 185.9 | ![]() |
Lymphoma_burkitts(Raji) | 237.7 | ![]() |
MedullaOblongata | 205.6 | ![]() |
OccipitalLobe | 200.6 | ![]() |
OlfactoryBulb | 84.1 | ![]() |
Ovary | 78.15 | ![]() |
Pancreas | 158.65 | ![]() |
PancreaticIslet | 161.65 | ![]() |
ParietalLobe | 177.75 | ![]() |
Pituitary | 127.2 | ![]() |
Placenta | 81.65 | ![]() |
Pons | 172.65 | ![]() |
PrefrontalCortex | 353.45 | ![]() |
Prostate | 251.15 | ![]() |
Salivarygland | 98 | ![]() |
SkeletalMuscle | 128.15 | ![]() |
Skin | 113.1 | ![]() |
SmoothMuscle | 119.95 | ![]() |
Spinalcord | 131.2 | ![]() |
SubthalamicNucleus | 152.4 | ![]() |
SuperiorCervicalGanglion | 81.55 | ![]() |
TemporalLobe | 197.4 | ![]() |
Testis | 87.8 | ![]() |
TestisGermCell | 77.5 | ![]() |
TestisIntersitial | 59.25 | ![]() |
TestisLeydigCell | 68.3 | ![]() |
TestisSeminiferousTubule | 49.3 | ![]() |
Thalamus | 175.5 | ![]() |
Thymus | 167.65 | ![]() |
Thyroid | 263.05 | ![]() |
Tongue | 117.75 | ![]() |
Tonsil | 123.3 | ![]() |
Trachea | 102.7 | ![]() |
TrigeminalGanglion | 114.7 | ![]() |
Uterus | 122.15 | ![]() |
UterusCorpus | 161.7 | ![]() |
WholeBlood | 141.55 | ![]() |
Wholebrain | 457.65 | ![]() |
colon | 109.65 | ![]() |
pineal_day | 283.64 | ![]() |
pineal_night | 276.54 | ![]() |
retina | 207.425 | ![]() |
small_intestine | 92.95 | ![]() |
- Probe name: CUST_6537_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 8.9 ± 0.24 | ![]() ![]() ![]() |
Basal Forebrain | 8.48 ± 0.14 | ![]() ![]() ![]() |
Basal Part of Pons | 9.02 ± 0.3 | ![]() ![]() ![]() |
Cerebellar Cortex | 8.54 ± 0.19 | ![]() ![]() ![]() |
Cerebellar Nuclei | 8.57 ± 0.35 | ![]() ![]() ![]() |
Claustrum | 9.11 ± 0.3 | ![]() ![]() ![]() |
Epithalamus | 8.14 ± 0.18 | ![]() ![]() ![]() |
Frontal Lobe | 8.69 ± 0.37 | ![]() ![]() ![]() |
Globus Pallidus | 8.17 ± 0.28 | ![]() ![]() ![]() |
Hypothalamus | 8.42 ± 0.26 | ![]() ![]() ![]() |
Insula | 8.63 ± 0.26 | ![]() ![]() ![]() |
Limbic Lobe | 8.87 ± 0.34 | ![]() ![]() ![]() |
Mesencephalon | 8.48 ± 0.32 | ![]() ![]() ![]() |
Myelencephalon | 8.67 ± 0.33 | ![]() ![]() ![]() |
Occipital Lobe | 8.95 ± 0.25 | ![]() ![]() ![]() |
Parietal Lobe | 8.94 ± 0.3 | ![]() ![]() ![]() |
Pontine Tegmentum | 8.65 ± 0.25 | ![]() ![]() ![]() |
Striatum | 8.58 ± 0.34 | ![]() ![]() ![]() |
Subthalamus | 8.55 ± 0.18 | ![]() ![]() ![]() |
Temporal Lobe | 8.77 ± 0.29 | ![]() ![]() ![]() |
Thalamus | 8.54 ± 0.27 | ![]() ![]() ![]() |
White Matter | 8.32 ± 0.44 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Actr1b | CB | Cerebellum | 97.27 | ![]() |
100 | ![]() | |||
Actr1b | CTX | Cerebral cortex | 100 | ![]() |
100 | ![]() | |||
Actr1b | HIP | Hippocampal region | 100 | ![]() |
100 | ![]() | |||
Actr1b | HPF | Hippocampal formation | 100 | ![]() |
100 | ![]() | |||
Actr1b | HY | Hypothalamus | 100 | ![]() |
100 | ![]() | |||
Actr1b | LSX | Lateral septal complex | 100 | ![]() |
100 | ![]() | |||
Actr1b | MB | Midbrain | 100 | ![]() |
100 | ![]() | |||
Actr1b | MY | Medulla | 100 | ![]() |
100 | ![]() | |||
Actr1b | OLF | Olfactory bulb | 100 | ![]() |
100 | ![]() | |||
Actr1b | P | Pons | 96.97 | ![]() |
100 | ![]() | |||
Actr1b | PAL | Pallidum | 100 | ![]() |
100 | ![]() | |||
Actr1b | RHP | Retrohippocampal region | 100 | ![]() |
100 | ![]() | |||
Actr1b | sAMY | Striatum-like amygdalar nuclei | 100 | ![]() |
100 | ![]() | |||
Actr1b | STR | Striatum | 100 | ![]() |
100 | ![]() | |||
Actr1b | STRd | Striatum dorsal region | 100 | ![]() |
100 | ![]() | |||
Actr1b | STRv | Striatum ventral region | 100 | ![]() |
100 | ![]() | |||
Actr1b | TH | Thalamus | 100 | ![]() |
100 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
ACTY_HUMAN_152 | 30 | 152 | 181 | TTGVVLDSGDGVTHAVPIYEGFAMPHSIMR | PRIDE |
ACTY_HUMAN_320 | 5 | 320 | 324 | KLAPK | PRIDE |
ACTY_HUMAN_336 | 19 | 336 | 354 | LYSTWIGGSILASLDTFKK | PRIDE |
ACTY_HUMAN_46 | 15 | 46 | 60 | VMAGALEGDLFIGPK | PRIDE |
ACTY_HUMAN_73 | 9 | 73 | 81 | YPMEHGVVR | PRIDE |
ACTY_HUMAN_82 | 7 | 82 | 88 | DWNDMER | PRIDE |
PAp00007990 | 30 | 153 | 182 | TTGVVLDSGDGVTHAVPIYEGFAMPHSIMR | Peptide Atlas |