Annotation Detail for ACTR1B
Basic Information Top
| Gene Symbol: | ACTR1B ( ARP1B,CTRN2,PC3 ) |
|---|---|
| Gene Full Name: | ARP1 actin-related protein 1 homolog B, centractin beta (yeast) |
| Band: | 2q11.2 |
| Quick Links | Entrez ID:10120; OMIM: 605144; Uniprot ID:ACTY_HUMAN; ENSEMBL ID: ENSG00000115073; HGNC ID: 168 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.98791
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 1 / 70761 | 14 | |
| blastocyst | 3 / 62319 | 48 | |
| fetus | 21 / 564012 | 37 | |
| neonate | 0 / 31097 | 0 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 5 / 55556 | 89 | |
| adult | 140 / 1939121 | 72 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 15 / 94178 | 159 | |
| cervical tumor | 5 / 34366 | 145 | |
| chondrosarcoma | 8 / 82823 | 96 | |
| colorectal tumor | 12 / 114246 | 105 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 9 / 119369 | 75 | |
| germ cell tumor | 12 / 263845 | 45 | |
| glioma | 16 / 106883 | 149 | |
| head and neck tumor | 5 / 136302 | 36 | |
| kidney tumor | 5 / 68959 | 72 | |
| leukemia | 4 / 95842 | 41 | |
| liver tumor | 2 / 96359 | 20 | |
| lung tumor | 4 / 103127 | 38 | |
| lymphoma | 9 / 71755 | 125 | |
| non-neoplasia | 5 / 97250 | 51 | |
| normal | 156 / 3360307 | 46 | |
| ovarian tumor | 7 / 76682 | 91 | |
| pancreatic tumor | 4 / 104616 | 38 | |
| primitive neuroectodermal tumor of the CNS | 27 / 125680 | 214 | |
| prostate cancer | 1 / 102680 | 9 | |
| retinoblastoma | 8 / 46356 | 172 | |
| skin tumor | 11 / 124949 | 88 | |
| soft tissue/muscle tissue tumor | 6 / 125191 | 47 | |
| uterine tumor | 4 / 90257 | 44 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 7 / 40015 | 174 | |
| bladder | 0 / 29757 | 0 | |
| blood | 7 / 123478 | 56 | |
| bone | 8 / 71655 | 111 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 56 / 1100989 | 50 | |
| cervix | 11 / 48171 | 228 | |
| connective tissue | 5 / 149255 | 33 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 8 / 215722 | 37 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 30 / 211054 | 142 | |
| heart | 10 / 89626 | 111 | |
| intestine | 18 / 234472 | 76 | |
| kidney | 13 / 211777 | 61 | |
| larynx | 0 / 24145 | 0 | |
| liver | 5 / 207743 | 24 | |
| lung | 21 / 336974 | 62 | |
| lymph | 5 / 44270 | 112 | |
| lymph node | 2 / 91610 | 21 | |
| mammary gland | 16 / 153271 | 104 | |
| mouth | 0 / 67052 | 0 | |
| muscle | 5 / 107715 | 46 | |
| nerve | 3 / 15768 | 190 | |
| ovary | 14 / 102051 | 137 | |
| pancreas | 4 / 214812 | 18 | |
| parathyroid | 2 / 20539 | 97 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 13 / 280825 | 46 | |
| prostate | 8 / 189345 | 42 | |
| salivary gland | 3 / 20155 | 148 | |
| skin | 11 / 210574 | 52 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 3 / 96619 | 31 | |
| testis | 2 / 330442 | 6 | |
| thymus | 1 / 81131 | 12 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 2 / 16999 | 117 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 8 / 232878 | 34 | |
| vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202135_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 274.5 | |
| Adipocyte | 76.6 | |
| AdrenalCortex | 162.9 | |
| Adrenalgland | 175.35 | |
| Amygdala | 202.55 | |
| Appendix | 70.2 | |
| AtrioventricularNode | 45.95 | |
| BDCA4+_DentriticCells | 160.8 | |
| Bonemarrow | 111 | |
| BronchialEpithelialCells | 73.9 | |
| CD105+_Endothelial | 118.05 | |
| CD14+_Monocytes | 161.05 | |
| CD19+_BCells(neg._sel.) | 314.1 | |
| CD33+_Myeloid | 191 | |
| CD34+ | 205.55 | |
| CD4+_Tcells | 337.35 | |
| CD56+_NKCells | 264.15 | |
| CD71+_EarlyErythroid | 44.25 | |
| CD8+_Tcells | 296.15 | |
| CardiacMyocytes | 113.35 | |
| Caudatenucleus | 145.55 | |
| Cerebellum | 166.75 | |
| CerebellumPeduncles | 211.7 | |
| CiliaryGanglion | 42.75 | |
| CingulateCortex | 200.1 | |
| Colorectaladenocarcinoma | 349.3 | |
| DorsalRootGanglion | 67.6 | |
| FetalThyroid | 137.1 | |
| Fetalbrain | 123.1 | |
| Fetalliver | 93.4 | |
| Fetallung | 90.35 | |
| GlobusPallidus | 133.9 | |
| Heart | 292.8 | |
| Hypothalamus | 183.7 | |
| Kidney | 116.55 | |
| Leukemia_chronicMyelogenousK-562 | 109.25 | |
| Leukemia_promyelocytic-HL-60 | 130.35 | |
| Leukemialymphoblastic(MOLT-4) | 263.55 | |
| Liver | 256 | |
| Lung | 185.7 | |
| Lymphnode | 125.6 | |
| Lymphoma_burkitts(Daudi) | 185.9 | |
| Lymphoma_burkitts(Raji) | 237.7 | |
| MedullaOblongata | 205.6 | |
| OccipitalLobe | 200.6 | |
| OlfactoryBulb | 84.1 | |
| Ovary | 78.15 | |
| Pancreas | 158.65 | |
| PancreaticIslet | 161.65 | |
| ParietalLobe | 177.75 | |
| Pituitary | 127.2 | |
| Placenta | 81.65 | |
| Pons | 172.65 | |
| PrefrontalCortex | 353.45 | |
| Prostate | 251.15 | |
| Salivarygland | 98 | |
| SkeletalMuscle | 128.15 | |
| Skin | 113.1 | |
| SmoothMuscle | 119.95 | |
| Spinalcord | 131.2 | |
| SubthalamicNucleus | 152.4 | |
| SuperiorCervicalGanglion | 81.55 | |
| TemporalLobe | 197.4 | |
| Testis | 87.8 | |
| TestisGermCell | 77.5 | |
| TestisIntersitial | 59.25 | |
| TestisLeydigCell | 68.3 | |
| TestisSeminiferousTubule | 49.3 | |
| Thalamus | 175.5 | |
| Thymus | 167.65 | |
| Thyroid | 263.05 | |
| Tongue | 117.75 | |
| Tonsil | 123.3 | |
| Trachea | 102.7 | |
| TrigeminalGanglion | 114.7 | |
| Uterus | 122.15 | |
| UterusCorpus | 161.7 | |
| WholeBlood | 141.55 | |
| Wholebrain | 457.65 | |
| colon | 109.65 | |
| pineal_day | 283.64 | |
| pineal_night | 276.54 | |
| retina | 207.425 | |
| small_intestine | 92.95 |
- Probe name: CUST_6537_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 8.9 ± 0.24 | |
| Basal Forebrain | 8.48 ± 0.14 | |
| Basal Part of Pons | 9.02 ± 0.3 | |
| Cerebellar Cortex | 8.54 ± 0.19 | |
| Cerebellar Nuclei | 8.57 ± 0.35 | |
| Claustrum | 9.11 ± 0.3 | |
| Epithalamus | 8.14 ± 0.18 | |
| Frontal Lobe | 8.69 ± 0.37 | |
| Globus Pallidus | 8.17 ± 0.28 | |
| Hypothalamus | 8.42 ± 0.26 | |
| Insula | 8.63 ± 0.26 | |
| Limbic Lobe | 8.87 ± 0.34 | |
| Mesencephalon | 8.48 ± 0.32 | |
| Myelencephalon | 8.67 ± 0.33 | |
| Occipital Lobe | 8.95 ± 0.25 | |
| Parietal Lobe | 8.94 ± 0.3 | |
| Pontine Tegmentum | 8.65 ± 0.25 | |
| Striatum | 8.58 ± 0.34 | |
| Subthalamus | 8.55 ± 0.18 | |
| Temporal Lobe | 8.77 ± 0.29 | |
| Thalamus | 8.54 ± 0.27 | |
| White Matter | 8.32 ± 0.44 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Actr1b | CB | Cerebellum | 97.27 | |
| 100 | ||||
| Actr1b | CTX | Cerebral cortex | 100 | |
| 100 | ||||
| Actr1b | HIP | Hippocampal region | 100 | |
| 100 | ||||
| Actr1b | HPF | Hippocampal formation | 100 | |
| 100 | ||||
| Actr1b | HY | Hypothalamus | 100 | |
| 100 | ||||
| Actr1b | LSX | Lateral septal complex | 100 | |
| 100 | ||||
| Actr1b | MB | Midbrain | 100 | |
| 100 | ||||
| Actr1b | MY | Medulla | 100 | |
| 100 | ||||
| Actr1b | OLF | Olfactory bulb | 100 | |
| 100 | ||||
| Actr1b | P | Pons | 96.97 | |
| 100 | ||||
| Actr1b | PAL | Pallidum | 100 | |
| 100 | ||||
| Actr1b | RHP | Retrohippocampal region | 100 | |
| 100 | ||||
| Actr1b | sAMY | Striatum-like amygdalar nuclei | 100 | |
| 100 | ||||
| Actr1b | STR | Striatum | 100 | |
| 100 | ||||
| Actr1b | STRd | Striatum dorsal region | 100 | |
| 100 | ||||
| Actr1b | STRv | Striatum ventral region | 100 | |
| 100 | ||||
| Actr1b | TH | Thalamus | 100 | |
| 100 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| ACTY_HUMAN_152 | 30 | 152 | 181 | TTGVVLDSGDGVTHAVPIYEGFAMPHSIMR | PRIDE |
| ACTY_HUMAN_320 | 5 | 320 | 324 | KLAPK | PRIDE |
| ACTY_HUMAN_336 | 19 | 336 | 354 | LYSTWIGGSILASLDTFKK | PRIDE |
| ACTY_HUMAN_46 | 15 | 46 | 60 | VMAGALEGDLFIGPK | PRIDE |
| ACTY_HUMAN_73 | 9 | 73 | 81 | YPMEHGVVR | PRIDE |
| ACTY_HUMAN_82 | 7 | 82 | 88 | DWNDMER | PRIDE |
| PAp00007990 | 30 | 153 | 182 | TTGVVLDSGDGVTHAVPIYEGFAMPHSIMR | Peptide Atlas |



