Annotation Detail for TNK2
Basic Information Top
Gene Symbol: | TNK2 ( ACK,ACK1,FLJ44758,FLJ45547,p21cdc42Hs ) |
---|---|
Gene Full Name: | tyrosine kinase, non-receptor, 2 |
Band: | 3q29 |
Quick Links | Entrez ID:10188; OMIM: 606994; Uniprot ID:ACK1_HUMAN; ENSEMBL ID: ENSG00000061938; HGNC ID: 19297 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.518513
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 4 / 70761 | 56 | |
blastocyst | 6 / 62319 | 96 | |
fetus | 20 / 564012 | 35 | |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 1 / 55556 | 17 | |
adult | 90 / 1939121 | 46 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 2 / 17475 | 114 | |
breast (mammary gland) tumor | 4 / 94178 | 42 | |
cervical tumor | 2 / 34366 | 58 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 7 / 114246 | 61 | |
esophageal tumor | 4 / 17290 | 231 | |
gastrointestinal tumor | 2 / 119369 | 16 | |
germ cell tumor | 7 / 263845 | 26 | |
glioma | 39 / 106883 | 364 | |
head and neck tumor | 8 / 136302 | 58 | |
kidney tumor | 2 / 68959 | 29 | |
leukemia | 14 / 95842 | 146 | |
liver tumor | 2 / 96359 | 20 | |
lung tumor | 6 / 103127 | 58 | |
lymphoma | 7 / 71755 | 97 | |
non-neoplasia | 2 / 97250 | 20 | |
normal | 159 / 3360307 | 47 | |
ovarian tumor | 2 / 76682 | 26 | |
pancreatic tumor | 6 / 104616 | 57 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 11 / 102680 | 107 | |
retinoblastoma | 1 / 46356 | 21 | |
skin tumor | 10 / 124949 | 80 | |
soft tissue/muscle tissue tumor | 6 / 125191 | 47 | |
uterine tumor | 5 / 90257 | 55 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 1 / 33197 | 30 | |
ascites | 1 / 40015 | 24 | |
bladder | 1 / 29757 | 33 | |
blood | 6 / 123478 | 48 | |
bone | 0 / 71655 | 0 | |
bone marrow | 3 / 48801 | 61 | |
brain | 99 / 1100989 | 89 | |
cervix | 2 / 48171 | 41 | |
connective tissue | 5 / 149255 | 33 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 12 / 215722 | 55 | |
esophagus | 4 / 20209 | 197 | |
eye | 6 / 211054 | 28 | |
heart | 2 / 89626 | 22 | |
intestine | 7 / 234472 | 29 | |
kidney | 6 / 211777 | 28 | |
larynx | 5 / 24145 | 207 | |
liver | 2 / 207743 | 9 | |
lung | 15 / 336974 | 44 | |
lymph | 3 / 44270 | 67 | |
lymph node | 19 / 91610 | 207 | |
mammary gland | 6 / 153271 | 39 | |
mouth | 2 / 67052 | 29 | |
muscle | 1 / 107715 | 9 | |
nerve | 4 / 15768 | 253 | |
ovary | 2 / 102051 | 19 | |
pancreas | 18 / 214812 | 83 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 4 / 280825 | 14 | |
prostate | 16 / 189345 | 84 | |
salivary gland | 2 / 20155 | 99 | |
skin | 11 / 210574 | 52 | |
spleen | 3 / 53952 | 55 | |
stomach | 4 / 96619 | 41 | |
testis | 6 / 330442 | 18 | |
thymus | 7 / 81131 | 86 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 1 / 16999 | 58 | |
trachea | 1 / 52413 | 19 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 9 / 232878 | 38 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 203839_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 99.25 | |
Adipocyte | 33.2 | |
AdrenalCortex | 40.25 | |
Adrenalgland | 23.5 | |
Amygdala | 222.55 | |
Appendix | 36.85 | |
AtrioventricularNode | 24.8 | |
BDCA4+_DentriticCells | 209.35 | |
Bonemarrow | 41.95 | |
BronchialEpithelialCells | 26 | |
CD105+_Endothelial | 108.8 | |
CD14+_Monocytes | 283.25 | |
CD19+_BCells(neg._sel.) | 246.7 | |
CD33+_Myeloid | 305.7 | |
CD34+ | 309 | |
CD4+_Tcells | 262.45 | |
CD56+_NKCells | 145.7 | |
CD71+_EarlyErythroid | 177.85 | |
CD8+_Tcells | 218.55 | |
CardiacMyocytes | 81.75 | |
Caudatenucleus | 152.9 | |
Cerebellum | 42.35 | |
CerebellumPeduncles | 77.1 | |
CiliaryGanglion | 23.2 | |
CingulateCortex | 186.75 | |
Colorectaladenocarcinoma | 430.45 | |
DorsalRootGanglion | 23.6 | |
FetalThyroid | 27.95 | |
Fetalbrain | 64.45 | |
Fetalliver | 31.8 | |
Fetallung | 31.45 | |
GlobusPallidus | 69.8 | |
Heart | 54.55 | |
Hypothalamus | 163.35 | |
Kidney | 23.3 | |
Leukemia_chronicMyelogenousK-562 | 30.15 | |
Leukemia_promyelocytic-HL-60 | 31.5 | |
Leukemialymphoblastic(MOLT-4) | 33.8 | |
Liver | 38.1 | |
Lung | 36.55 | |
Lymphnode | 84.15 | |
Lymphoma_burkitts(Daudi) | 53.7 | |
Lymphoma_burkitts(Raji) | 105.05 | |
MedullaOblongata | 68.4 | |
OccipitalLobe | 82.7 | |
OlfactoryBulb | 45.7 | |
Ovary | 24.35 | |
Pancreas | 29.65 | |
PancreaticIslet | 30.25 | |
ParietalLobe | 62.45 | |
Pituitary | 46.55 | |
Placenta | 31.2 | |
Pons | 69.65 | |
PrefrontalCortex | 373.05 | |
Prostate | 62.2 | |
Salivarygland | 33.75 | |
SkeletalMuscle | 50.8 | |
Skin | 32.7 | |
SmoothMuscle | 26.25 | |
Spinalcord | 98.65 | |
SubthalamicNucleus | 108.85 | |
SuperiorCervicalGanglion | 33.45 | |
TemporalLobe | 70.85 | |
Testis | 26.85 | |
TestisGermCell | 39 | |
TestisIntersitial | 26.8 | |
TestisLeydigCell | 32.6 | |
TestisSeminiferousTubule | 29.9 | |
Thalamus | 109.05 | |
Thymus | 27.05 | |
Thyroid | 57.05 | |
Tongue | 35.75 | |
Tonsil | 54.05 | |
Trachea | 24.5 | |
TrigeminalGanglion | 35.85 | |
Uterus | 30.5 | |
UterusCorpus | 27.8 | |
WholeBlood | 80.35 | |
Wholebrain | 108.35 | |
colon | 38.75 | |
pineal_day | 233.42 | |
pineal_night | 186.4 | |
retina | 69.25 | |
small_intestine | 36.1 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_32_P180741
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 6.66 ± 0.57 | |
Basal Forebrain | 6.56 ± 0.27 | |
Basal Part of Pons | 6.2 ± 0.66 | |
Cerebellar Cortex | 5.75 ± 0.3 | |
Cerebellar Nuclei | 6.14 ± 0.29 | |
Claustrum | 6.95 ± 0.75 | |
Epithalamus | 5.18 ± 0.58 | |
Frontal Lobe | 5.93 ± 0.54 | |
Globus Pallidus | 6.85 ± 0.24 | |
Hypothalamus | 5.83 ± 0.73 | |
Insula | 6.01 ± 0.59 | |
Limbic Lobe | 6.28 ± 0.66 | |
Mesencephalon | 6.35 ± 0.56 | |
Myelencephalon | 6.27 ± 0.6 | |
Occipital Lobe | 6.63 ± 0.64 | |
Parietal Lobe | 6.29 ± 0.59 | |
Pontine Tegmentum | 6.11 ± 0.55 | |
Striatum | 6.73 ± 0.62 | |
Subthalamus | 5.9 ± 0.42 | |
Temporal Lobe | 6.07 ± 0.53 | |
Thalamus | 6.12 ± 0.52 | |
White Matter | 6.18 ± 0.69 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Tnk2 | CB | Cerebellum | 4.59 | |
5.5 | ||||
Tnk2 | CTX | Cerebral cortex | 16.24 | |
11.05 | ||||
Tnk2 | HIP | Hippocampal region | 13.07 | |
13.18 | ||||
Tnk2 | HPF | Hippocampal formation | 12.74 | |
11.4 | ||||
Tnk2 | HY | Hypothalamus | 4.79 | |
3.76 | ||||
Tnk2 | LSX | Lateral septal complex | 0.96 | |
0.67 | ||||
Tnk2 | MB | Midbrain | 6.69 | |
6.6 | ||||
Tnk2 | MY | Medulla | 16.04 | |
20.06 | ||||
Tnk2 | OLF | Olfactory bulb | 14.15 | |
9.78 | ||||
Tnk2 | P | Pons | 13.27 | |
15.1 | ||||
Tnk2 | PAL | Pallidum | 5.43 | |
4.92 | ||||
Tnk2 | RHP | Retrohippocampal region | 12.55 | |
9.12 | ||||
Tnk2 | sAMY | Striatum-like amygdalar nuclei | 7.35 | |
4.81 | ||||
Tnk2 | STR | Striatum | 3.42 | |
2.42 | ||||
Tnk2 | STRd | Striatum dorsal region | 2.79 | |
2 | ||||
Tnk2 | STRv | Striatum ventral region | 4.86 | |
3.39 | ||||
Tnk2 | TH | Thalamus | 3.29 | |
2.85 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
ACK1_HUMAN_1004 | 31 | 1004 | 1034 | GECHKVLEMFDWNLEQAGCHLLGSWGPAHHK | PRIDE |
ACK1_HUMAN_349 | 33 | 349 | 381 | LPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALR | PRIDE |
PAp01144158 | 11 | 192 | 202 | LYGVVLTPPMK | Peptide Atlas |