Annotation Detail for DNAJA2
Basic Information Top
Gene Symbol: | DNAJA2 ( CPR3,DJ3,DJA2,DNAJ,DNJ3,HIRIP4,PRO3015,RDJ2 ) |
---|---|
Gene Full Name: | DnaJ (Hsp40) homolog, subfamily A, member 2 |
Band: | 16q11.2 |
Quick Links | Entrez ID:10294; OMIM: 611322; Uniprot ID:DNJA2_HUMAN; ENSEMBL ID: ENSG00000069345; HGNC ID: 14884 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.368078
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 4 / 70761 | 56 | |
blastocyst | 5 / 62319 | 80 | |
fetus | 36 / 564012 | 63 | |
neonate | 2 / 31097 | 64 | |
infant | 2 / 23620 | 84 | |
juvenile | 5 / 55556 | 89 | |
adult | 181 / 1939121 | 93 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 8 / 94178 | 84 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 5 / 82823 | 60 | |
colorectal tumor | 23 / 114246 | 201 | |
esophageal tumor | 2 / 17290 | 115 | |
gastrointestinal tumor | 6 / 119369 | 50 | |
germ cell tumor | 32 / 263845 | 121 | |
glioma | 2 / 106883 | 18 | |
head and neck tumor | 19 / 136302 | 139 | |
kidney tumor | 2 / 68959 | 29 | |
leukemia | 6 / 95842 | 62 | |
liver tumor | 14 / 96359 | 145 | |
lung tumor | 3 / 103127 | 29 | |
lymphoma | 3 / 71755 | 41 | |
non-neoplasia | 2 / 97250 | 20 | |
normal | 250 / 3360307 | 74 | |
ovarian tumor | 10 / 76682 | 130 | |
pancreatic tumor | 1 / 104616 | 9 | |
primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | |
prostate cancer | 9 / 102680 | 87 | |
retinoblastoma | 2 / 46356 | 43 | |
skin tumor | 9 / 124949 | 72 | |
soft tissue/muscle tissue tumor | 7 / 125191 | 55 | |
uterine tumor | 17 / 90257 | 188 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 1 / 13106 | 76 | |
adrenal gland | 2 / 33197 | 60 | |
ascites | 5 / 40015 | 124 | |
bladder | 2 / 29757 | 67 | |
blood | 12 / 123478 | 97 | |
bone | 14 / 71655 | 195 | |
bone marrow | 1 / 48801 | 20 | |
brain | 72 / 1100989 | 65 | |
cervix | 1 / 48171 | 20 | |
connective tissue | 4 / 149255 | 26 | |
ear | 1 / 16212 | 61 | |
embryonic tissue | 11 / 215722 | 50 | |
esophagus | 2 / 20209 | 98 | |
eye | 12 / 211054 | 56 | |
heart | 4 / 89626 | 44 | |
intestine | 30 / 234472 | 127 | |
kidney | 5 / 211777 | 23 | |
larynx | 5 / 24145 | 207 | |
liver | 21 / 207743 | 101 | |
lung | 18 / 336974 | 53 | |
lymph | 1 / 44270 | 22 | |
lymph node | 4 / 91610 | 43 | |
mammary gland | 14 / 153271 | 91 | |
mouth | 6 / 67052 | 89 | |
muscle | 13 / 107715 | 120 | |
nerve | 0 / 15768 | 0 | |
ovary | 10 / 102051 | 97 | |
pancreas | 7 / 214812 | 32 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 2 / 41328 | 48 | |
pituitary gland | 2 / 16585 | 120 | |
placenta | 29 / 280825 | 103 | |
prostate | 13 / 189345 | 68 | |
salivary gland | 1 / 20155 | 49 | |
skin | 13 / 210574 | 61 | |
spleen | 5 / 53952 | 92 | |
stomach | 4 / 96619 | 41 | |
testis | 42 / 330442 | 127 | |
thymus | 4 / 81131 | 49 | |
thyroid | 8 / 47473 | 168 | |
tonsil | 0 / 16999 | 0 | |
trachea | 3 / 52413 | 57 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 26 / 232878 | 111 | |
vascular | 2 / 51780 | 38 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 209157_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 67.2 | |
Adipocyte | 12.8 | |
AdrenalCortex | 10.8 | |
Adrenalgland | 9.85 | |
Amygdala | 33.4 | |
Appendix | 12.1 | |
AtrioventricularNode | 7.75 | |
BDCA4+_DentriticCells | 23.15 | |
Bonemarrow | 8.65 | |
BronchialEpithelialCells | 67.3 | |
CD105+_Endothelial | 12.9 | |
CD14+_Monocytes | 24.1 | |
CD19+_BCells(neg._sel.) | 27.15 | |
CD33+_Myeloid | 36.2 | |
CD34+ | 24 | |
CD4+_Tcells | 35.75 | |
CD56+_NKCells | 57.4 | |
CD71+_EarlyErythroid | 20.65 | |
CD8+_Tcells | 39.05 | |
CardiacMyocytes | 15.8 | |
Caudatenucleus | 10.95 | |
Cerebellum | 10.5 | |
CerebellumPeduncles | 14 | |
CiliaryGanglion | 6.25 | |
CingulateCortex | 14.85 | |
Colorectaladenocarcinoma | 17.15 | |
DorsalRootGanglion | 6.15 | |
FetalThyroid | 9.6 | |
Fetalbrain | 11.2 | |
Fetalliver | 10.35 | |
Fetallung | 8.5 | |
GlobusPallidus | 13.5 | |
Heart | 13.75 | |
Hypothalamus | 23.55 | |
Kidney | 9.8 | |
Leukemia_chronicMyelogenousK-562 | 9.9 | |
Leukemia_promyelocytic-HL-60 | 26.15 | |
Leukemialymphoblastic(MOLT-4) | 11.75 | |
Liver | 13.8 | |
Lung | 12.45 | |
Lymphnode | 10.15 | |
Lymphoma_burkitts(Daudi) | 15 | |
Lymphoma_burkitts(Raji) | 22 | |
MedullaOblongata | 10.65 | |
OccipitalLobe | 16.55 | |
OlfactoryBulb | 8.85 | |
Ovary | 6.45 | |
Pancreas | 9.8 | |
PancreaticIslet | 20.5 | |
ParietalLobe | 13.7 | |
Pituitary | 11.3 | |
Placenta | 23.5 | |
Pons | 10.6 | |
PrefrontalCortex | 31.85 | |
Prostate | 15.45 | |
Salivarygland | 10.85 | |
SkeletalMuscle | 12.75 | |
Skin | 7.3 | |
SmoothMuscle | 21.05 | |
Spinalcord | 11.7 | |
SubthalamicNucleus | 11.4 | |
SuperiorCervicalGanglion | 8.75 | |
TemporalLobe | 11.9 | |
Testis | 19.35 | |
TestisGermCell | 22.05 | |
TestisIntersitial | 11.25 | |
TestisLeydigCell | 12.5 | |
TestisSeminiferousTubule | 16.2 | |
Thalamus | 17.3 | |
Thymus | 10.4 | |
Thyroid | 16.4 | |
Tongue | 9.9 | |
Tonsil | 10.1 | |
Trachea | 10.55 | |
TrigeminalGanglion | 10.3 | |
Uterus | 20.5 | |
UterusCorpus | 10 | |
WholeBlood | 35.9 | |
Wholebrain | 58.7 | |
colon | 59.85 | |
pineal_day | 51.32 | |
pineal_night | 50.18 | |
retina | 24.425 | |
small_intestine | 68.35 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: CUST_9029_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 7.12 ± 0.26 | |
Basal Forebrain | 7.04 ± 0.22 | |
Basal Part of Pons | 7.52 ± 0.18 | |
Cerebellar Cortex | 7.01 ± 0.22 | |
Cerebellar Nuclei | 7.28 ± 0.33 | |
Claustrum | 7.06 ± 0.51 | |
Epithalamus | 7.24 ± 0.15 | |
Frontal Lobe | 7.29 ± 0.3 | |
Globus Pallidus | 6.6 ± 0.31 | |
Hypothalamus | 7.16 ± 0.47 | |
Insula | 7.21 ± 0.24 | |
Limbic Lobe | 7.15 ± 0.38 | |
Mesencephalon | 7.15 ± 0.36 | |
Myelencephalon | 7.15 ± 0.34 | |
Occipital Lobe | 7.06 ± 0.43 | |
Parietal Lobe | 7.24 ± 0.34 | |
Pontine Tegmentum | 7.1 ± 0.25 | |
Striatum | 7.17 ± 0.37 | |
Subthalamus | 7.4 ± 0.24 | |
Temporal Lobe | 7.25 ± 0.29 | |
Thalamus | 7.21 ± 0.23 | |
White Matter | 6.67 ± 0.11 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Dnaja2 | CB | Cerebellum | 29.82 | |
58.39 | ||||
Dnaja2 | CTX | Cerebral cortex | 100 | |
100 | ||||
Dnaja2 | HIP | Hippocampal region | 86.57 | |
100 | ||||
Dnaja2 | HPF | Hippocampal formation | 91.38 | |
100 | ||||
Dnaja2 | HY | Hypothalamus | 56.64 | |
52.68 | ||||
Dnaja2 | LSX | Lateral septal complex | 77.82 | |
71.26 | ||||
Dnaja2 | MB | Midbrain | 69.7 | |
76.04 | ||||
Dnaja2 | MY | Medulla | 60.37 | |
82.53 | ||||
Dnaja2 | OLF | Olfactory bulb | 60.92 | |
62.39 | ||||
Dnaja2 | P | Pons | 58.39 | |
77.2 | ||||
Dnaja2 | PAL | Pallidum | 58.24 | |
64.19 | ||||
Dnaja2 | RHP | Retrohippocampal region | 100 | |
100 | ||||
Dnaja2 | sAMY | Striatum-like amygdalar nuclei | 53.73 | |
48.77 | ||||
Dnaja2 | STR | Striatum | 63.01 | |
53.09 | ||||
Dnaja2 | STRd | Striatum dorsal region | 68.14 | |
57.65 | ||||
Dnaja2 | STRv | Striatum ventral region | 49.06 | |
38 | ||||
Dnaja2 | TH | Thalamus | 77.28 | |
83.93 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
DNJA2_HUMAN_2 | 28 | 2 | 29 | ANVADTKLYDILGVPPGASENELKKAYR | PRIDE |
DNJA2_HUMAN_230 | 32 | 230 | 261 | ITFTGEADQAPGVEPGDIVLLLQEKEHEVFQR | PRIDE |
DNJA2_HUMAN_272 | 15 | 272 | 286 | IGLVEALCGFQFTFK | PRIDE |
DNJA2_HUMAN_293 | 18 | 293 | 310 | QIVVKYPPGKVIEPGCVR | PRIDE |
PAp00003809 | 15 | 273 | 287 | IGLVEALCGFQFTFK | Peptide Atlas |