Annotation Detail for SEMA4D
Basic Information Top
Gene Symbol: | SEMA4D ( C9orf164,CD100,FLJ33485,FLJ34282,FLJ39737,FLJ46484,M-sema-G,MGC169138,MGC169141,SEMAJ,coll-4 ) |
---|---|
Gene Full Name: | sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D |
Band: | 9q22.2 |
Quick Links | Entrez ID:10507; OMIM: 601866; Uniprot ID:SEM4D_HUMAN; ENSEMBL ID: ENSG00000187764; HGNC ID: 10732 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.494406
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 1 / 70761 | 14 | |
blastocyst | 3 / 62319 | 48 | |
fetus | 17 / 564012 | 30 | |
neonate | 0 / 31097 | 0 | |
infant | 1 / 23620 | 42 | |
juvenile | 6 / 55556 | 107 | |
adult | 102 / 1939121 | 52 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 1 / 17475 | 57 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 2 / 114246 | 17 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 9 / 263845 | 34 | |
glioma | 4 / 106883 | 37 | |
head and neck tumor | 5 / 136302 | 36 | |
kidney tumor | 1 / 68959 | 14 | |
leukemia | 10 / 95842 | 104 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 11 / 97250 | 113 | |
normal | 171 / 3360307 | 50 | |
ovarian tumor | 2 / 76682 | 26 | |
pancreatic tumor | 2 / 104616 | 19 | |
primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | |
prostate cancer | 5 / 102680 | 48 | |
retinoblastoma | 2 / 46356 | 43 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 1 / 125191 | 7 | |
uterine tumor | 6 / 90257 | 66 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 18 / 123478 | 145 | |
bone | 0 / 71655 | 0 | |
bone marrow | 2 / 48801 | 40 | |
brain | 72 / 1100989 | 65 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 0 / 149255 | 0 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 6 / 215722 | 27 | |
esophagus | 0 / 20209 | 0 | |
eye | 7 / 211054 | 33 | |
heart | 0 / 89626 | 0 | |
intestine | 7 / 234472 | 29 | |
kidney | 7 / 211777 | 33 | |
larynx | 3 / 24145 | 124 | |
liver | 1 / 207743 | 4 | |
lung | 13 / 336974 | 38 | |
lymph | 0 / 44270 | 0 | |
lymph node | 21 / 91610 | 229 | |
mammary gland | 4 / 153271 | 26 | |
mouth | 0 / 67052 | 0 | |
muscle | 4 / 107715 | 37 | |
nerve | 2 / 15768 | 126 | |
ovary | 2 / 102051 | 19 | |
pancreas | 7 / 214812 | 32 | |
parathyroid | 3 / 20539 | 146 | |
pharynx | 1 / 41328 | 24 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 4 / 280825 | 14 | |
prostate | 16 / 189345 | 84 | |
salivary gland | 0 / 20155 | 0 | |
skin | 3 / 210574 | 14 | |
spleen | 1 / 53952 | 18 | |
stomach | 0 / 96619 | 0 | |
testis | 8 / 330442 | 24 | |
thymus | 7 / 81131 | 86 | |
thyroid | 3 / 47473 | 63 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 12 / 232878 | 51 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 203528_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 275.95 | |
Adipocyte | 12.8 | |
AdrenalCortex | 15 | |
Adrenalgland | 19.4 | |
Amygdala | 44.95 | |
Appendix | 16.5 | |
AtrioventricularNode | 6.9 | |
BDCA4+_DentriticCells | 291.25 | |
Bonemarrow | 126.5 | |
BronchialEpithelialCells | 12.6 | |
CD105+_Endothelial | 56.9 | |
CD14+_Monocytes | 431.6 | |
CD19+_BCells(neg._sel.) | 43.7 | |
CD33+_Myeloid | 1048.2 | |
CD34+ | 492.95 | |
CD4+_Tcells | 1437.8 | |
CD56+_NKCells | 1598.5 | |
CD71+_EarlyErythroid | 17.95 | |
CD8+_Tcells | 1613.7 | |
CardiacMyocytes | 18.05 | |
Caudatenucleus | 30.45 | |
Cerebellum | 14.65 | |
CerebellumPeduncles | 18.15 | |
CiliaryGanglion | 10.2 | |
CingulateCortex | 34.55 | |
Colorectaladenocarcinoma | 39.95 | |
DorsalRootGanglion | 8.05 | |
FetalThyroid | 16.1 | |
Fetalbrain | 16.35 | |
Fetalliver | 13.8 | |
Fetallung | 12.35 | |
GlobusPallidus | 12.05 | |
Heart | 19.45 | |
Hypothalamus | 153.35 | |
Kidney | 20.25 | |
Leukemia_chronicMyelogenousK-562 | 14.3 | |
Leukemia_promyelocytic-HL-60 | 12.95 | |
Leukemialymphoblastic(MOLT-4) | 447.2 | |
Liver | 21.45 | |
Lung | 82.45 | |
Lymphnode | 238.3 | |
Lymphoma_burkitts(Daudi) | 162.6 | |
Lymphoma_burkitts(Raji) | 105.85 | |
MedullaOblongata | 71.5 | |
OccipitalLobe | 46.8 | |
OlfactoryBulb | 29.1 | |
Ovary | 9.35 | |
Pancreas | 12.3 | |
PancreaticIslet | 17.05 | |
ParietalLobe | 57.5 | |
Pituitary | 16.8 | |
Placenta | 15.7 | |
Pons | 17.7 | |
PrefrontalCortex | 35.1 | |
Prostate | 54.8 | |
Salivarygland | 22.4 | |
SkeletalMuscle | 19.95 | |
Skin | 11.55 | |
SmoothMuscle | 14.45 | |
Spinalcord | 119 | |
SubthalamicNucleus | 27.75 | |
SuperiorCervicalGanglion | 16.75 | |
TemporalLobe | 13.7 | |
Testis | 24.35 | |
TestisGermCell | 21.35 | |
TestisIntersitial | 12.3 | |
TestisLeydigCell | 14.85 | |
TestisSeminiferousTubule | 13.85 | |
Thalamus | 44.25 | |
Thymus | 344.55 | |
Thyroid | 21.15 | |
Tongue | 28.1 | |
Tonsil | 104.55 | |
Trachea | 15.8 | |
TrigeminalGanglion | 14.75 | |
Uterus | 18.35 | |
UterusCorpus | 13.7 | |
WholeBlood | 1107.9 | |
Wholebrain | 80.7 | |
colon | 18.4 | |
pineal_day | 14.62 | |
pineal_night | 13.68 | |
retina | 69.9 | |
small_intestine | 23.1 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_24_P261169
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.17 ± 0.77 | |
Basal Forebrain | 2.8 ± 0.45 | |
Basal Part of Pons | 3.08 ± 0.58 | |
Cerebellar Cortex | 2.84 ± 0.56 | |
Cerebellar Nuclei | 3.34 ± 0.53 | |
Claustrum | 3.51 ± 0.66 | |
Epithalamus | 3.33 ± 0.97 | |
Frontal Lobe | 3.28 ± 0.64 | |
Globus Pallidus | 4.04 ± 0.47 | |
Hypothalamus | 3.33 ± 0.82 | |
Insula | 3.38 ± 0.52 | |
Limbic Lobe | 2.94 ± 0.75 | |
Mesencephalon | 3.31 ± 0.82 | |
Myelencephalon | 3.12 ± 0.7 | |
Occipital Lobe | 3 ± 0.66 | |
Parietal Lobe | 3.04 ± 0.77 | |
Pontine Tegmentum | 3.24 ± 0.73 | |
Striatum | 2.84 ± 0.77 | |
Subthalamus | 3.33 ± 0.36 | |
Temporal Lobe | 3.13 ± 0.69 | |
Thalamus | 3.3 ± 0.66 | |
White Matter | 5.06 ± 0.4 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Sema4d | CB | Cerebellum | 0.72 | |
0.93 | ||||
Sema4d | CTX | Cerebral cortex | 0.61 | |
0.66 | ||||
Sema4d | HIP | Hippocampal region | 0.59 | |
0.68 | ||||
Sema4d | HPF | Hippocampal formation | 0.57 | |
0.61 | ||||
Sema4d | HY | Hypothalamus | 0.69 | |
0.8 | ||||
Sema4d | LSX | Lateral septal complex | 0.58 | |
0.57 | ||||
Sema4d | MB | Midbrain | 0.84 | |
1.07 | ||||
Sema4d | MY | Medulla | 0.82 | |
0.91 | ||||
Sema4d | OLF | Olfactory bulb | 2.3 | |
1.58 | ||||
Sema4d | P | Pons | 0.9 | |
1.15 | ||||
Sema4d | PAL | Pallidum | 1.11 | |
1.29 | ||||
Sema4d | RHP | Retrohippocampal region | 0.51 | |
0.48 | ||||
Sema4d | sAMY | Striatum-like amygdalar nuclei | 0.58 | |
0.63 | ||||
Sema4d | STR | Striatum | 0.72 | |
0.76 | ||||
Sema4d | STRd | Striatum dorsal region | 0.77 | |
0.84 | ||||
Sema4d | STRv | Striatum ventral region | 0.66 | |
0.65 | ||||
Sema4d | TH | Thalamus | 0.99 | |
1.06 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00039416 | 31 | 451 | 481 | AISLEHAVHIIEETQLFQDFEPVQTLLLSSK | Peptide Atlas |
SEM4D_HUMAN_367 | 10 | 367 | 376 | PGACIDSEAR | PRIDE |