Annotation Detail for SEMA4D
Basic Information Top
| Gene Symbol: | SEMA4D ( C9orf164,CD100,FLJ33485,FLJ34282,FLJ39737,FLJ46484,M-sema-G,MGC169138,MGC169141,SEMAJ,coll-4 ) |
|---|---|
| Gene Full Name: | sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D |
| Band: | 9q22.2 |
| Quick Links | Entrez ID:10507; OMIM: 601866; Uniprot ID:SEM4D_HUMAN; ENSEMBL ID: ENSG00000187764; HGNC ID: 10732 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.494406
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 1 / 70761 | 14 | |
| blastocyst | 3 / 62319 | 48 | |
| fetus | 17 / 564012 | 30 | |
| neonate | 0 / 31097 | 0 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 6 / 55556 | 107 | |
| adult | 102 / 1939121 | 52 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 1 / 17475 | 57 | |
| breast (mammary gland) tumor | 1 / 94178 | 10 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 0 / 82823 | 0 | |
| colorectal tumor | 2 / 114246 | 17 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 0 / 119369 | 0 | |
| germ cell tumor | 9 / 263845 | 34 | |
| glioma | 4 / 106883 | 37 | |
| head and neck tumor | 5 / 136302 | 36 | |
| kidney tumor | 1 / 68959 | 14 | |
| leukemia | 10 / 95842 | 104 | |
| liver tumor | 0 / 96359 | 0 | |
| lung tumor | 0 / 103127 | 0 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 11 / 97250 | 113 | |
| normal | 171 / 3360307 | 50 | |
| ovarian tumor | 2 / 76682 | 26 | |
| pancreatic tumor | 2 / 104616 | 19 | |
| primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | |
| prostate cancer | 5 / 102680 | 48 | |
| retinoblastoma | 2 / 46356 | 43 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 1 / 125191 | 7 | |
| uterine tumor | 6 / 90257 | 66 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 0 / 29757 | 0 | |
| blood | 18 / 123478 | 145 | |
| bone | 0 / 71655 | 0 | |
| bone marrow | 2 / 48801 | 40 | |
| brain | 72 / 1100989 | 65 | |
| cervix | 0 / 48171 | 0 | |
| connective tissue | 0 / 149255 | 0 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 6 / 215722 | 27 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 7 / 211054 | 33 | |
| heart | 0 / 89626 | 0 | |
| intestine | 7 / 234472 | 29 | |
| kidney | 7 / 211777 | 33 | |
| larynx | 3 / 24145 | 124 | |
| liver | 1 / 207743 | 4 | |
| lung | 13 / 336974 | 38 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 21 / 91610 | 229 | |
| mammary gland | 4 / 153271 | 26 | |
| mouth | 0 / 67052 | 0 | |
| muscle | 4 / 107715 | 37 | |
| nerve | 2 / 15768 | 126 | |
| ovary | 2 / 102051 | 19 | |
| pancreas | 7 / 214812 | 32 | |
| parathyroid | 3 / 20539 | 146 | |
| pharynx | 1 / 41328 | 24 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 4 / 280825 | 14 | |
| prostate | 16 / 189345 | 84 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 3 / 210574 | 14 | |
| spleen | 1 / 53952 | 18 | |
| stomach | 0 / 96619 | 0 | |
| testis | 8 / 330442 | 24 | |
| thymus | 7 / 81131 | 86 | |
| thyroid | 3 / 47473 | 63 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 12 / 232878 | 51 | |
| vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 203528_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 275.95 | |
| Adipocyte | 12.8 | |
| AdrenalCortex | 15 | |
| Adrenalgland | 19.4 | |
| Amygdala | 44.95 | |
| Appendix | 16.5 | |
| AtrioventricularNode | 6.9 | |
| BDCA4+_DentriticCells | 291.25 | |
| Bonemarrow | 126.5 | |
| BronchialEpithelialCells | 12.6 | |
| CD105+_Endothelial | 56.9 | |
| CD14+_Monocytes | 431.6 | |
| CD19+_BCells(neg._sel.) | 43.7 | |
| CD33+_Myeloid | 1048.2 | |
| CD34+ | 492.95 | |
| CD4+_Tcells | 1437.8 | |
| CD56+_NKCells | 1598.5 | |
| CD71+_EarlyErythroid | 17.95 | |
| CD8+_Tcells | 1613.7 | |
| CardiacMyocytes | 18.05 | |
| Caudatenucleus | 30.45 | |
| Cerebellum | 14.65 | |
| CerebellumPeduncles | 18.15 | |
| CiliaryGanglion | 10.2 | |
| CingulateCortex | 34.55 | |
| Colorectaladenocarcinoma | 39.95 | |
| DorsalRootGanglion | 8.05 | |
| FetalThyroid | 16.1 | |
| Fetalbrain | 16.35 | |
| Fetalliver | 13.8 | |
| Fetallung | 12.35 | |
| GlobusPallidus | 12.05 | |
| Heart | 19.45 | |
| Hypothalamus | 153.35 | |
| Kidney | 20.25 | |
| Leukemia_chronicMyelogenousK-562 | 14.3 | |
| Leukemia_promyelocytic-HL-60 | 12.95 | |
| Leukemialymphoblastic(MOLT-4) | 447.2 | |
| Liver | 21.45 | |
| Lung | 82.45 | |
| Lymphnode | 238.3 | |
| Lymphoma_burkitts(Daudi) | 162.6 | |
| Lymphoma_burkitts(Raji) | 105.85 | |
| MedullaOblongata | 71.5 | |
| OccipitalLobe | 46.8 | |
| OlfactoryBulb | 29.1 | |
| Ovary | 9.35 | |
| Pancreas | 12.3 | |
| PancreaticIslet | 17.05 | |
| ParietalLobe | 57.5 | |
| Pituitary | 16.8 | |
| Placenta | 15.7 | |
| Pons | 17.7 | |
| PrefrontalCortex | 35.1 | |
| Prostate | 54.8 | |
| Salivarygland | 22.4 | |
| SkeletalMuscle | 19.95 | |
| Skin | 11.55 | |
| SmoothMuscle | 14.45 | |
| Spinalcord | 119 | |
| SubthalamicNucleus | 27.75 | |
| SuperiorCervicalGanglion | 16.75 | |
| TemporalLobe | 13.7 | |
| Testis | 24.35 | |
| TestisGermCell | 21.35 | |
| TestisIntersitial | 12.3 | |
| TestisLeydigCell | 14.85 | |
| TestisSeminiferousTubule | 13.85 | |
| Thalamus | 44.25 | |
| Thymus | 344.55 | |
| Thyroid | 21.15 | |
| Tongue | 28.1 | |
| Tonsil | 104.55 | |
| Trachea | 15.8 | |
| TrigeminalGanglion | 14.75 | |
| Uterus | 18.35 | |
| UterusCorpus | 13.7 | |
| WholeBlood | 1107.9 | |
| Wholebrain | 80.7 | |
| colon | 18.4 | |
| pineal_day | 14.62 | |
| pineal_night | 13.68 | |
| retina | 69.9 | |
| small_intestine | 23.1 |
- Probe name: A_24_P261169
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 3.17 ± 0.77 | |
| Basal Forebrain | 2.8 ± 0.45 | |
| Basal Part of Pons | 3.08 ± 0.58 | |
| Cerebellar Cortex | 2.84 ± 0.56 | |
| Cerebellar Nuclei | 3.34 ± 0.53 | |
| Claustrum | 3.51 ± 0.66 | |
| Epithalamus | 3.33 ± 0.97 | |
| Frontal Lobe | 3.28 ± 0.64 | |
| Globus Pallidus | 4.04 ± 0.47 | |
| Hypothalamus | 3.33 ± 0.82 | |
| Insula | 3.38 ± 0.52 | |
| Limbic Lobe | 2.94 ± 0.75 | |
| Mesencephalon | 3.31 ± 0.82 | |
| Myelencephalon | 3.12 ± 0.7 | |
| Occipital Lobe | 3 ± 0.66 | |
| Parietal Lobe | 3.04 ± 0.77 | |
| Pontine Tegmentum | 3.24 ± 0.73 | |
| Striatum | 2.84 ± 0.77 | |
| Subthalamus | 3.33 ± 0.36 | |
| Temporal Lobe | 3.13 ± 0.69 | |
| Thalamus | 3.3 ± 0.66 | |
| White Matter | 5.06 ± 0.4 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Sema4d | CB | Cerebellum | 0.72 | |
| 0.93 | ||||
| Sema4d | CTX | Cerebral cortex | 0.61 | |
| 0.66 | ||||
| Sema4d | HIP | Hippocampal region | 0.59 | |
| 0.68 | ||||
| Sema4d | HPF | Hippocampal formation | 0.57 | |
| 0.61 | ||||
| Sema4d | HY | Hypothalamus | 0.69 | |
| 0.8 | ||||
| Sema4d | LSX | Lateral septal complex | 0.58 | |
| 0.57 | ||||
| Sema4d | MB | Midbrain | 0.84 | |
| 1.07 | ||||
| Sema4d | MY | Medulla | 0.82 | |
| 0.91 | ||||
| Sema4d | OLF | Olfactory bulb | 2.3 | |
| 1.58 | ||||
| Sema4d | P | Pons | 0.9 | |
| 1.15 | ||||
| Sema4d | PAL | Pallidum | 1.11 | |
| 1.29 | ||||
| Sema4d | RHP | Retrohippocampal region | 0.51 | |
| 0.48 | ||||
| Sema4d | sAMY | Striatum-like amygdalar nuclei | 0.58 | |
| 0.63 | ||||
| Sema4d | STR | Striatum | 0.72 | |
| 0.76 | ||||
| Sema4d | STRd | Striatum dorsal region | 0.77 | |
| 0.84 | ||||
| Sema4d | STRv | Striatum ventral region | 0.66 | |
| 0.65 | ||||
| Sema4d | TH | Thalamus | 0.99 | |
| 1.06 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00039416 | 31 | 451 | 481 | AISLEHAVHIIEETQLFQDFEPVQTLLLSSK | Peptide Atlas |
| SEM4D_HUMAN_367 | 10 | 367 | 376 | PGACIDSEAR | PRIDE |



