Annotation Detail for ATG7


Gene Symbol: | ATG7 ( APG7-LIKE,APG7L,DKFZp434N0735,GSA7 ) |
---|---|
Gene Full Name: | ATG7 autophagy related 7 homolog (S. cerevisiae) |
Band: | 3p25.3 |
Quick Links | Entrez ID:10533; OMIM: 608760; Uniprot ID:ATG7_HUMAN; ENSEMBL ID: ENSG00000197548; HGNC ID: 16935 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.38032
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 6 / 70761 | 84 | ![]() |
blastocyst | 2 / 62319 | 32 | ![]() |
fetus | 40 / 564012 | 70 | ![]() |
neonate | 3 / 31097 | 96 | ![]() |
infant | 3 / 23620 | 127 | ![]() |
juvenile | 1 / 55556 | 17 | ![]() |
adult | 129 / 1939121 | 66 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | ![]() |
cervical tumor | 3 / 34366 | 87 | ![]() |
chondrosarcoma | 1 / 82823 | 12 | ![]() |
colorectal tumor | 13 / 114246 | 113 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 7 / 119369 | 58 | ![]() |
germ cell tumor | 15 / 263845 | 56 | ![]() |
glioma | 11 / 106883 | 102 | ![]() |
head and neck tumor | 7 / 136302 | 51 | ![]() |
kidney tumor | 3 / 68959 | 43 | ![]() |
leukemia | 4 / 95842 | 41 | ![]() |
liver tumor | 12 / 96359 | 124 | ![]() |
lung tumor | 5 / 103127 | 48 | ![]() |
lymphoma | 5 / 71755 | 69 | ![]() |
non-neoplasia | 6 / 97250 | 61 | ![]() |
normal | 238 / 3360307 | 70 | ![]() |
ovarian tumor | 4 / 76682 | 52 | ![]() |
pancreatic tumor | 4 / 104616 | 38 | ![]() |
primitive neuroectodermal tumor of the CNS | 16 / 125680 | 127 | ![]() |
prostate cancer | 6 / 102680 | 58 | ![]() |
retinoblastoma | 1 / 46356 | 21 | ![]() |
skin tumor | 14 / 124949 | 112 | ![]() |
soft tissue/muscle tissue tumor | 4 / 125191 | 31 | ![]() |
uterine tumor | 3 / 90257 | 33 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 2 / 33197 | 60 | ![]() |
ascites | 2 / 40015 | 49 | ![]() |
bladder | 2 / 29757 | 67 | ![]() |
blood | 7 / 123478 | 56 | ![]() |
bone | 1 / 71655 | 13 | ![]() |
bone marrow | 8 / 48801 | 163 | ![]() |
brain | 81 / 1100989 | 73 | ![]() |
cervix | 5 / 48171 | 103 | ![]() |
connective tissue | 8 / 149255 | 53 | ![]() |
ear | 2 / 16212 | 123 | ![]() |
embryonic tissue | 10 / 215722 | 46 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 10 / 211054 | 47 | ![]() |
heart | 11 / 89626 | 122 | ![]() |
intestine | 24 / 234472 | 102 | ![]() |
kidney | 12 / 211777 | 56 | ![]() |
larynx | 1 / 24145 | 41 | ![]() |
liver | 15 / 207743 | 72 | ![]() |
lung | 23 / 336974 | 68 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 2 / 91610 | 21 | ![]() |
mammary gland | 6 / 153271 | 39 | ![]() |
mouth | 3 / 67052 | 44 | ![]() |
muscle | 5 / 107715 | 46 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 9 / 102051 | 88 | ![]() |
pancreas | 6 / 214812 | 27 | ![]() |
parathyroid | 2 / 20539 | 97 | ![]() |
pharynx | 6 / 41328 | 145 | ![]() |
pituitary gland | 0 / 16585 | 0 | |
placenta | 24 / 280825 | 85 | ![]() |
prostate | 11 / 189345 | 58 | ![]() |
salivary gland | 1 / 20155 | 49 | ![]() |
skin | 23 / 210574 | 109 | ![]() |
spleen | 3 / 53952 | 55 | ![]() |
stomach | 5 / 96619 | 51 | ![]() |
testis | 16 / 330442 | 48 | ![]() |
thymus | 1 / 81131 | 12 | ![]() |
thyroid | 2 / 47473 | 42 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 7 / 52413 | 133 | ![]() |
umbilical cord | 1 / 13680 | 73 | ![]() |
uterus | 11 / 232878 | 47 | ![]() |
vascular | 2 / 51780 | 38 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218673_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 7.9 | ![]() |
Adipocyte | 3.4 | ![]() |
AdrenalCortex | 3.55 | ![]() |
Adrenalgland | 2.9 | ![]() |
Amygdala | 3.7 | ![]() |
Appendix | 3.45 | ![]() |
AtrioventricularNode | 2.75 | ![]() |
BDCA4+_DentriticCells | 5.6 | ![]() |
Bonemarrow | 3.4 | ![]() |
BronchialEpithelialCells | 3.45 | ![]() |
CD105+_Endothelial | 4.25 | ![]() |
CD14+_Monocytes | 21.3 | ![]() |
CD19+_BCells(neg._sel.) | 3.7 | ![]() |
CD33+_Myeloid | 17.7 | ![]() |
CD34+ | 5 | ![]() |
CD4+_Tcells | 3.75 | ![]() |
CD56+_NKCells | 5.9 | ![]() |
CD71+_EarlyErythroid | 3.25 | ![]() |
CD8+_Tcells | 3.4 | ![]() |
CardiacMyocytes | 4.3 | ![]() |
Caudatenucleus | 3.05 | ![]() |
Cerebellum | 2.8 | ![]() |
CerebellumPeduncles | 3.85 | ![]() |
CiliaryGanglion | 2.5 | ![]() |
CingulateCortex | 3.55 | ![]() |
Colorectaladenocarcinoma | 3.45 | ![]() |
DorsalRootGanglion | 2.6 | ![]() |
FetalThyroid | 3.35 | ![]() |
Fetalbrain | 3.4 | ![]() |
Fetalliver | 2.95 | ![]() |
Fetallung | 2.9 | ![]() |
GlobusPallidus | 2.5 | ![]() |
Heart | 4.35 | ![]() |
Hypothalamus | 3.85 | ![]() |
Kidney | 2.75 | ![]() |
Leukemia_chronicMyelogenousK-562 | 3.2 | ![]() |
Leukemia_promyelocytic-HL-60 | 3 | ![]() |
Leukemialymphoblastic(MOLT-4) | 2.7 | ![]() |
Liver | 4.6 | ![]() |
Lung | 4.1 | ![]() |
Lymphnode | 3 | ![]() |
Lymphoma_burkitts(Daudi) | 4.4 | ![]() |
Lymphoma_burkitts(Raji) | 4.8 | ![]() |
MedullaOblongata | 3.25 | ![]() |
OccipitalLobe | 3.1 | ![]() |
OlfactoryBulb | 2.7 | ![]() |
Ovary | 2.25 | ![]() |
Pancreas | 2.7 | ![]() |
PancreaticIslet | 3.7 | ![]() |
ParietalLobe | 3.65 | ![]() |
Pituitary | 3.95 | ![]() |
Placenta | 3.7 | ![]() |
Pons | 3.3 | ![]() |
PrefrontalCortex | 4.85 | ![]() |
Prostate | 4.25 | ![]() |
Salivarygland | 2.75 | ![]() |
SkeletalMuscle | 3.9 | ![]() |
Skin | 2.6 | ![]() |
SmoothMuscle | 6 | ![]() |
Spinalcord | 3.7 | ![]() |
SubthalamicNucleus | 3.1 | ![]() |
SuperiorCervicalGanglion | 4.35 | ![]() |
TemporalLobe | 3.15 | ![]() |
Testis | 3.9 | ![]() |
TestisGermCell | 2.9 | ![]() |
TestisIntersitial | 2.9 | ![]() |
TestisLeydigCell | 3.4 | ![]() |
TestisSeminiferousTubule | 3.05 | ![]() |
Thalamus | 3.5 | ![]() |
Thymus | 2.8 | ![]() |
Thyroid | 4.4 | ![]() |
Tongue | 3.3 | ![]() |
Tonsil | 3.4 | ![]() |
Trachea | 2.85 | ![]() |
TrigeminalGanglion | 3.4 | ![]() |
Uterus | 2.95 | ![]() |
UterusCorpus | 3.05 | ![]() |
WholeBlood | 12.85 | ![]() |
Wholebrain | 6 | ![]() |
colon | 3.5 | ![]() |
pineal_day | 4.34 | ![]() |
pineal_night | 4.24 | ![]() |
retina | 4.275 | ![]() |
small_intestine | 3.4 | ![]() |
- Probe name: A_23_P143987
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.86 ± 0.53 | ![]() ![]() ![]() |
Basal Forebrain | 6.09 ± 0.27 | ![]() ![]() ![]() |
Basal Part of Pons | 6.41 ± 0.38 | ![]() ![]() ![]() |
Cerebellar Cortex | 6.05 ± 0.37 | ![]() ![]() ![]() |
Cerebellar Nuclei | 5.88 ± 0.6 | ![]() ![]() ![]() |
Claustrum | 5.63 ± 0.65 | ![]() ![]() ![]() |
Epithalamus | 6.22 ± 0.54 | ![]() ![]() ![]() |
Frontal Lobe | 6.35 ± 0.36 | ![]() ![]() ![]() |
Globus Pallidus | 5.78 ± 0.33 | ![]() ![]() ![]() |
Hypothalamus | 6.17 ± 0.24 | ![]() ![]() ![]() |
Insula | 6.38 ± 0.26 | ![]() ![]() ![]() |
Limbic Lobe | 6.13 ± 0.53 | ![]() ![]() ![]() |
Mesencephalon | 6.1 ± 0.45 | ![]() ![]() ![]() |
Myelencephalon | 6.11 ± 0.5 | ![]() ![]() ![]() |
Occipital Lobe | 5.85 ± 0.43 | ![]() ![]() ![]() |
Parietal Lobe | 6.17 ± 0.47 | ![]() ![]() ![]() |
Pontine Tegmentum | 6.07 ± 0.55 | ![]() ![]() ![]() |
Striatum | 5.74 ± 0.82 | ![]() ![]() ![]() |
Subthalamus | 5.5 ± 0.71 | ![]() ![]() ![]() |
Temporal Lobe | 6.32 ± 0.45 | ![]() ![]() ![]() |
Thalamus | 6.13 ± 0.44 | ![]() ![]() ![]() |
White Matter | 5.97 ± 0.19 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Atg7 | CB | Cerebellum | 2.44 | ![]() |
2.49 | ![]() | |||
Atg7 | CTX | Cerebral cortex | 2.76 | ![]() |
2 | ![]() | |||
Atg7 | HIP | Hippocampal region | 4.32 | ![]() |
3.49 | ![]() | |||
Atg7 | HPF | Hippocampal formation | 5.52 | ![]() |
4.44 | ![]() | |||
Atg7 | HY | Hypothalamus | 3.23 | ![]() |
3.75 | ![]() | |||
Atg7 | LSX | Lateral septal complex | 0.31 | ![]() |
0.19 | ![]() | |||
Atg7 | MB | Midbrain | 2.69 | ![]() |
3.56 | ![]() | |||
Atg7 | MY | Medulla | 8.23 | ![]() |
8.93 | ![]() | |||
Atg7 | OLF | Olfactory bulb | 9.78 | ![]() |
8.36 | ![]() | |||
Atg7 | P | Pons | 6.93 | ![]() |
8.61 | ![]() | |||
Atg7 | PAL | Pallidum | 1.16 | ![]() |
1.03 | ![]() | |||
Atg7 | RHP | Retrohippocampal region | 9.76 | ![]() |
7.38 | ![]() | |||
Atg7 | sAMY | Striatum-like amygdalar nuclei | 0.74 | ![]() |
0.42 | ![]() | |||
Atg7 | STR | Striatum | 0.91 | ![]() |
0.65 | ![]() | |||
Atg7 | STRd | Striatum dorsal region | 0.77 | ![]() |
0.56 | ![]() | |||
Atg7 | STRv | Striatum ventral region | 1.95 | ![]() |
1.36 | ![]() | |||
Atg7 | TH | Thalamus | 3.17 | ![]() |
2.4 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
ATG7_HUMAN_102 | 15 | 102 | 116 | LLLEQAANEIWESIK | PRIDE |
ATG7_HUMAN_432 | 24 | 432 | 455 | GFNMSIPMPGHPVNFSSVTLEQAR | PRIDE |
PAp00006454 | 31 | 517 | 547 | QQGAGDLCPNHPVASADLLGSSLFANIPGYK | Peptide Atlas |