Annotation Detail for ATG7
Basic Information Top
| Gene Symbol: | ATG7 ( APG7-LIKE,APG7L,DKFZp434N0735,GSA7 ) |
|---|---|
| Gene Full Name: | ATG7 autophagy related 7 homolog (S. cerevisiae) |
| Band: | 3p25.3 |
| Quick Links | Entrez ID:10533; OMIM: 608760; Uniprot ID:ATG7_HUMAN; ENSEMBL ID: ENSG00000197548; HGNC ID: 16935 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.38032
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 6 / 70761 | 84 | |
| blastocyst | 2 / 62319 | 32 | |
| fetus | 40 / 564012 | 70 | |
| neonate | 3 / 31097 | 96 | |
| infant | 3 / 23620 | 127 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 129 / 1939121 | 66 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 1 / 94178 | 10 | |
| cervical tumor | 3 / 34366 | 87 | |
| chondrosarcoma | 1 / 82823 | 12 | |
| colorectal tumor | 13 / 114246 | 113 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 7 / 119369 | 58 | |
| germ cell tumor | 15 / 263845 | 56 | |
| glioma | 11 / 106883 | 102 | |
| head and neck tumor | 7 / 136302 | 51 | |
| kidney tumor | 3 / 68959 | 43 | |
| leukemia | 4 / 95842 | 41 | |
| liver tumor | 12 / 96359 | 124 | |
| lung tumor | 5 / 103127 | 48 | |
| lymphoma | 5 / 71755 | 69 | |
| non-neoplasia | 6 / 97250 | 61 | |
| normal | 238 / 3360307 | 70 | |
| ovarian tumor | 4 / 76682 | 52 | |
| pancreatic tumor | 4 / 104616 | 38 | |
| primitive neuroectodermal tumor of the CNS | 16 / 125680 | 127 | |
| prostate cancer | 6 / 102680 | 58 | |
| retinoblastoma | 1 / 46356 | 21 | |
| skin tumor | 14 / 124949 | 112 | |
| soft tissue/muscle tissue tumor | 4 / 125191 | 31 | |
| uterine tumor | 3 / 90257 | 33 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 2 / 33197 | 60 | |
| ascites | 2 / 40015 | 49 | |
| bladder | 2 / 29757 | 67 | |
| blood | 7 / 123478 | 56 | |
| bone | 1 / 71655 | 13 | |
| bone marrow | 8 / 48801 | 163 | |
| brain | 81 / 1100989 | 73 | |
| cervix | 5 / 48171 | 103 | |
| connective tissue | 8 / 149255 | 53 | |
| ear | 2 / 16212 | 123 | |
| embryonic tissue | 10 / 215722 | 46 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 10 / 211054 | 47 | |
| heart | 11 / 89626 | 122 | |
| intestine | 24 / 234472 | 102 | |
| kidney | 12 / 211777 | 56 | |
| larynx | 1 / 24145 | 41 | |
| liver | 15 / 207743 | 72 | |
| lung | 23 / 336974 | 68 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 2 / 91610 | 21 | |
| mammary gland | 6 / 153271 | 39 | |
| mouth | 3 / 67052 | 44 | |
| muscle | 5 / 107715 | 46 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 9 / 102051 | 88 | |
| pancreas | 6 / 214812 | 27 | |
| parathyroid | 2 / 20539 | 97 | |
| pharynx | 6 / 41328 | 145 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 24 / 280825 | 85 | |
| prostate | 11 / 189345 | 58 | |
| salivary gland | 1 / 20155 | 49 | |
| skin | 23 / 210574 | 109 | |
| spleen | 3 / 53952 | 55 | |
| stomach | 5 / 96619 | 51 | |
| testis | 16 / 330442 | 48 | |
| thymus | 1 / 81131 | 12 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 7 / 52413 | 133 | |
| umbilical cord | 1 / 13680 | 73 | |
| uterus | 11 / 232878 | 47 | |
| vascular | 2 / 51780 | 38 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218673_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 7.9 | |
| Adipocyte | 3.4 | |
| AdrenalCortex | 3.55 | |
| Adrenalgland | 2.9 | |
| Amygdala | 3.7 | |
| Appendix | 3.45 | |
| AtrioventricularNode | 2.75 | |
| BDCA4+_DentriticCells | 5.6 | |
| Bonemarrow | 3.4 | |
| BronchialEpithelialCells | 3.45 | |
| CD105+_Endothelial | 4.25 | |
| CD14+_Monocytes | 21.3 | |
| CD19+_BCells(neg._sel.) | 3.7 | |
| CD33+_Myeloid | 17.7 | |
| CD34+ | 5 | |
| CD4+_Tcells | 3.75 | |
| CD56+_NKCells | 5.9 | |
| CD71+_EarlyErythroid | 3.25 | |
| CD8+_Tcells | 3.4 | |
| CardiacMyocytes | 4.3 | |
| Caudatenucleus | 3.05 | |
| Cerebellum | 2.8 | |
| CerebellumPeduncles | 3.85 | |
| CiliaryGanglion | 2.5 | |
| CingulateCortex | 3.55 | |
| Colorectaladenocarcinoma | 3.45 | |
| DorsalRootGanglion | 2.6 | |
| FetalThyroid | 3.35 | |
| Fetalbrain | 3.4 | |
| Fetalliver | 2.95 | |
| Fetallung | 2.9 | |
| GlobusPallidus | 2.5 | |
| Heart | 4.35 | |
| Hypothalamus | 3.85 | |
| Kidney | 2.75 | |
| Leukemia_chronicMyelogenousK-562 | 3.2 | |
| Leukemia_promyelocytic-HL-60 | 3 | |
| Leukemialymphoblastic(MOLT-4) | 2.7 | |
| Liver | 4.6 | |
| Lung | 4.1 | |
| Lymphnode | 3 | |
| Lymphoma_burkitts(Daudi) | 4.4 | |
| Lymphoma_burkitts(Raji) | 4.8 | |
| MedullaOblongata | 3.25 | |
| OccipitalLobe | 3.1 | |
| OlfactoryBulb | 2.7 | |
| Ovary | 2.25 | |
| Pancreas | 2.7 | |
| PancreaticIslet | 3.7 | |
| ParietalLobe | 3.65 | |
| Pituitary | 3.95 | |
| Placenta | 3.7 | |
| Pons | 3.3 | |
| PrefrontalCortex | 4.85 | |
| Prostate | 4.25 | |
| Salivarygland | 2.75 | |
| SkeletalMuscle | 3.9 | |
| Skin | 2.6 | |
| SmoothMuscle | 6 | |
| Spinalcord | 3.7 | |
| SubthalamicNucleus | 3.1 | |
| SuperiorCervicalGanglion | 4.35 | |
| TemporalLobe | 3.15 | |
| Testis | 3.9 | |
| TestisGermCell | 2.9 | |
| TestisIntersitial | 2.9 | |
| TestisLeydigCell | 3.4 | |
| TestisSeminiferousTubule | 3.05 | |
| Thalamus | 3.5 | |
| Thymus | 2.8 | |
| Thyroid | 4.4 | |
| Tongue | 3.3 | |
| Tonsil | 3.4 | |
| Trachea | 2.85 | |
| TrigeminalGanglion | 3.4 | |
| Uterus | 2.95 | |
| UterusCorpus | 3.05 | |
| WholeBlood | 12.85 | |
| Wholebrain | 6 | |
| colon | 3.5 | |
| pineal_day | 4.34 | |
| pineal_night | 4.24 | |
| retina | 4.275 | |
| small_intestine | 3.4 |
- Probe name: A_23_P143987
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 5.86 ± 0.53 | |
| Basal Forebrain | 6.09 ± 0.27 | |
| Basal Part of Pons | 6.41 ± 0.38 | |
| Cerebellar Cortex | 6.05 ± 0.37 | |
| Cerebellar Nuclei | 5.88 ± 0.6 | |
| Claustrum | 5.63 ± 0.65 | |
| Epithalamus | 6.22 ± 0.54 | |
| Frontal Lobe | 6.35 ± 0.36 | |
| Globus Pallidus | 5.78 ± 0.33 | |
| Hypothalamus | 6.17 ± 0.24 | |
| Insula | 6.38 ± 0.26 | |
| Limbic Lobe | 6.13 ± 0.53 | |
| Mesencephalon | 6.1 ± 0.45 | |
| Myelencephalon | 6.11 ± 0.5 | |
| Occipital Lobe | 5.85 ± 0.43 | |
| Parietal Lobe | 6.17 ± 0.47 | |
| Pontine Tegmentum | 6.07 ± 0.55 | |
| Striatum | 5.74 ± 0.82 | |
| Subthalamus | 5.5 ± 0.71 | |
| Temporal Lobe | 6.32 ± 0.45 | |
| Thalamus | 6.13 ± 0.44 | |
| White Matter | 5.97 ± 0.19 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Atg7 | CB | Cerebellum | 2.44 | |
| 2.49 | ||||
| Atg7 | CTX | Cerebral cortex | 2.76 | |
| 2 | ||||
| Atg7 | HIP | Hippocampal region | 4.32 | |
| 3.49 | ||||
| Atg7 | HPF | Hippocampal formation | 5.52 | |
| 4.44 | ||||
| Atg7 | HY | Hypothalamus | 3.23 | |
| 3.75 | ||||
| Atg7 | LSX | Lateral septal complex | 0.31 | |
| 0.19 | ||||
| Atg7 | MB | Midbrain | 2.69 | |
| 3.56 | ||||
| Atg7 | MY | Medulla | 8.23 | |
| 8.93 | ||||
| Atg7 | OLF | Olfactory bulb | 9.78 | |
| 8.36 | ||||
| Atg7 | P | Pons | 6.93 | |
| 8.61 | ||||
| Atg7 | PAL | Pallidum | 1.16 | |
| 1.03 | ||||
| Atg7 | RHP | Retrohippocampal region | 9.76 | |
| 7.38 | ||||
| Atg7 | sAMY | Striatum-like amygdalar nuclei | 0.74 | |
| 0.42 | ||||
| Atg7 | STR | Striatum | 0.91 | |
| 0.65 | ||||
| Atg7 | STRd | Striatum dorsal region | 0.77 | |
| 0.56 | ||||
| Atg7 | STRv | Striatum ventral region | 1.95 | |
| 1.36 | ||||
| Atg7 | TH | Thalamus | 3.17 | |
| 2.4 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| ATG7_HUMAN_102 | 15 | 102 | 116 | LLLEQAANEIWESIK | PRIDE |
| ATG7_HUMAN_432 | 24 | 432 | 455 | GFNMSIPMPGHPVNFSSVTLEQAR | PRIDE |
| PAp00006454 | 31 | 517 | 547 | QQGAGDLCPNHPVASADLLGSSLFANIPGYK | Peptide Atlas |



