Annotation Detail for RALBP1
Basic Information Top
| Gene Symbol: | RALBP1 ( RIP1,RLIP1,RLIP76 ) |
|---|---|
| Gene Full Name: | ralA binding protein 1 |
| Band: | 18p11.22 |
| Quick Links | Entrez ID:10928; OMIM: 605801; Uniprot ID:RBP1_HUMAN; ENSEMBL ID: ENSG00000017797; HGNC ID: 9841 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.528993
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 1 / 70761 | 14 | |
| blastocyst | 0 / 62319 | 0 | |
| fetus | 17 / 564012 | 30 | |
| neonate | 0 / 31097 | 0 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 0 / 55556 | 0 | |
| adult | 73 / 1939121 | 37 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 6 / 94178 | 63 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 1 / 82823 | 12 | |
| colorectal tumor | 3 / 114246 | 26 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 5 / 119369 | 41 | |
| germ cell tumor | 5 / 263845 | 18 | |
| glioma | 1 / 106883 | 9 | |
| head and neck tumor | 14 / 136302 | 102 | |
| kidney tumor | 1 / 68959 | 14 | |
| leukemia | 2 / 95842 | 20 | |
| liver tumor | 7 / 96359 | 72 | |
| lung tumor | 3 / 103127 | 29 | |
| lymphoma | 1 / 71755 | 13 | |
| non-neoplasia | 0 / 97250 | 0 | |
| normal | 72 / 3360307 | 21 | |
| ovarian tumor | 1 / 76682 | 13 | |
| pancreatic tumor | 1 / 104616 | 9 | |
| primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | |
| prostate cancer | 3 / 102680 | 29 | |
| retinoblastoma | 1 / 46356 | 21 | |
| skin tumor | 2 / 124949 | 16 | |
| soft tissue/muscle tissue tumor | 3 / 125191 | 23 | |
| uterine tumor | 2 / 90257 | 22 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 2 / 33197 | 60 | |
| ascites | 3 / 40015 | 74 | |
| bladder | 0 / 29757 | 0 | |
| blood | 2 / 123478 | 16 | |
| bone | 1 / 71655 | 13 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 3 / 1100989 | 2 | |
| cervix | 0 / 48171 | 0 | |
| connective tissue | 0 / 149255 | 0 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 2 / 215722 | 9 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 7 / 211054 | 33 | |
| heart | 3 / 89626 | 33 | |
| intestine | 6 / 234472 | 25 | |
| kidney | 4 / 211777 | 18 | |
| larynx | 0 / 24145 | 0 | |
| liver | 10 / 207743 | 48 | |
| lung | 7 / 336974 | 20 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 5 / 91610 | 54 | |
| mammary gland | 7 / 153271 | 45 | |
| mouth | 14 / 67052 | 208 | |
| muscle | 2 / 107715 | 18 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 1 / 102051 | 9 | |
| pancreas | 6 / 214812 | 27 | |
| parathyroid | 1 / 20539 | 48 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 11 / 280825 | 39 | |
| prostate | 4 / 189345 | 21 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 6 / 210574 | 28 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 2 / 96619 | 20 | |
| testis | 3 / 330442 | 9 | |
| thymus | 1 / 81131 | 12 | |
| thyroid | 1 / 47473 | 21 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 8 / 232878 | 34 | |
| vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202844_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 92.75 | |
| Adipocyte | 53.4 | |
| AdrenalCortex | 56.85 | |
| Adrenalgland | 30.8 | |
| Amygdala | 78.25 | |
| Appendix | 36.65 | |
| AtrioventricularNode | 41.75 | |
| BDCA4+_DentriticCells | 113.55 | |
| Bonemarrow | 31.25 | |
| BronchialEpithelialCells | 77.85 | |
| CD105+_Endothelial | 454.75 | |
| CD14+_Monocytes | 119.75 | |
| CD19+_BCells(neg._sel.) | 136.15 | |
| CD33+_Myeloid | 261.6 | |
| CD34+ | 195.4 | |
| CD4+_Tcells | 60.8 | |
| CD56+_NKCells | 211 | |
| CD71+_EarlyErythroid | 196.7 | |
| CD8+_Tcells | 96.1 | |
| CardiacMyocytes | 53.05 | |
| Caudatenucleus | 24.65 | |
| Cerebellum | 26.2 | |
| CerebellumPeduncles | 50.1 | |
| CiliaryGanglion | 36.05 | |
| CingulateCortex | 82.45 | |
| Colorectaladenocarcinoma | 47.9 | |
| DorsalRootGanglion | 30.45 | |
| FetalThyroid | 39.35 | |
| Fetalbrain | 31.95 | |
| Fetalliver | 34.25 | |
| Fetallung | 23.65 | |
| GlobusPallidus | 30.1 | |
| Heart | 32.05 | |
| Hypothalamus | 41 | |
| Kidney | 29.85 | |
| Leukemia_chronicMyelogenousK-562 | 26 | |
| Leukemia_promyelocytic-HL-60 | 59.95 | |
| Leukemialymphoblastic(MOLT-4) | 34.55 | |
| Liver | 51.55 | |
| Lung | 60.35 | |
| Lymphnode | 25.2 | |
| Lymphoma_burkitts(Daudi) | 40 | |
| Lymphoma_burkitts(Raji) | 36.7 | |
| MedullaOblongata | 49.3 | |
| OccipitalLobe | 43.2 | |
| OlfactoryBulb | 136.25 | |
| Ovary | 23.4 | |
| Pancreas | 31.7 | |
| PancreaticIslet | 44.45 | |
| ParietalLobe | 53.35 | |
| Pituitary | 27.05 | |
| Placenta | 77 | |
| Pons | 35.4 | |
| PrefrontalCortex | 70.15 | |
| Prostate | 204 | |
| Salivarygland | 18.8 | |
| SkeletalMuscle | 58.35 | |
| Skin | 49.75 | |
| SmoothMuscle | 56.7 | |
| Spinalcord | 33.3 | |
| SubthalamicNucleus | 55.15 | |
| SuperiorCervicalGanglion | 54.65 | |
| TemporalLobe | 49.4 | |
| Testis | 30.75 | |
| TestisGermCell | 27.6 | |
| TestisIntersitial | 26.3 | |
| TestisLeydigCell | 34 | |
| TestisSeminiferousTubule | 35 | |
| Thalamus | 26.45 | |
| Thymus | 49.95 | |
| Thyroid | 63.05 | |
| Tongue | 83.9 | |
| Tonsil | 37.9 | |
| Trachea | 24.1 | |
| TrigeminalGanglion | 44.85 | |
| Uterus | 52.65 | |
| UterusCorpus | 40.45 | |
| WholeBlood | 52.7 | |
| Wholebrain | 67.95 | |
| colon | 144.45 | |
| pineal_day | 45.1 | |
| pineal_night | 45.74 | |
| retina | 50.15 | |
| small_intestine | 51.9 |
- Probe name: A_24_P230457
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 10.43 ± 0.24 | |
| Basal Forebrain | 10.58 ± 0.22 | |
| Basal Part of Pons | 10.52 ± 0.17 | |
| Cerebellar Cortex | 10.67 ± 0.12 | |
| Cerebellar Nuclei | 10.62 ± 0.18 | |
| Claustrum | 10.95 ± 0.17 | |
| Epithalamus | 10.97 ± 0.24 | |
| Frontal Lobe | 10.72 ± 0.22 | |
| Globus Pallidus | 10.8 ± 0.27 | |
| Hypothalamus | 10.67 ± 0.13 | |
| Insula | 10.73 ± 0.12 | |
| Limbic Lobe | 10.6 ± 0.25 | |
| Mesencephalon | 10.63 ± 0.21 | |
| Myelencephalon | 10.62 ± 0.24 | |
| Occipital Lobe | 10.45 ± 0.3 | |
| Parietal Lobe | 10.73 ± 0.19 | |
| Pontine Tegmentum | 10.66 ± 0.25 | |
| Striatum | 10.29 ± 0.28 | |
| Subthalamus | 10.76 ± 0.18 | |
| Temporal Lobe | 10.68 ± 0.17 | |
| Thalamus | 10.63 ± 0.22 | |
| White Matter | 10.83 ± 0.07 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Ralbp1 | CB | Cerebellum | 3.74 | |
| 3.89 | ||||
| Ralbp1 | CTX | Cerebral cortex | 20.63 | |
| 10.21 | ||||
| Ralbp1 | HIP | Hippocampal region | 6.75 | |
| 4.8 | ||||
| Ralbp1 | HPF | Hippocampal formation | 8.04 | |
| 4.79 | ||||
| Ralbp1 | HY | Hypothalamus | 2.7 | |
| 1.37 | ||||
| Ralbp1 | LSX | Lateral septal complex | 0.74 | |
| 0.68 | ||||
| Ralbp1 | MB | Midbrain | 3.57 | |
| 2.58 | ||||
| Ralbp1 | MY | Medulla | 10.16 | |
| 6.22 | ||||
| Ralbp1 | OLF | Olfactory bulb | 9.25 | |
| 6.19 | ||||
| Ralbp1 | P | Pons | 5.52 | |
| 3.07 | ||||
| Ralbp1 | PAL | Pallidum | 4.15 | |
| 2.11 | ||||
| Ralbp1 | RHP | Retrohippocampal region | 11.23 | |
| 5.1 | ||||
| Ralbp1 | sAMY | Striatum-like amygdalar nuclei | 4.03 | |
| 1.43 | ||||
| Ralbp1 | STR | Striatum | 4.22 | |
| 2.02 | ||||
| Ralbp1 | STRd | Striatum dorsal region | 4.66 | |
| 2.25 | ||||
| Ralbp1 | STRv | Striatum ventral region | 4.94 | |
| 2.33 | ||||
| Ralbp1 | TH | Thalamus | 2.42 | |
| 1.33 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00133474 | 31 | 170 | 200 | KKPIQEPEVPQIDVPNLKPIFGIPLADAVER | Peptide Atlas |



