Annotation Detail for RALBP1


Gene Symbol: | RALBP1 ( RIP1,RLIP1,RLIP76 ) |
---|---|
Gene Full Name: | ralA binding protein 1 |
Band: | 18p11.22 |
Quick Links | Entrez ID:10928; OMIM: 605801; Uniprot ID:RBP1_HUMAN; ENSEMBL ID: ENSG00000017797; HGNC ID: 9841 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.528993
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 1 / 70761 | 14 | ![]() |
blastocyst | 0 / 62319 | 0 | |
fetus | 17 / 564012 | 30 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 73 / 1939121 | 37 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 6 / 94178 | 63 | ![]() |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 1 / 82823 | 12 | ![]() |
colorectal tumor | 3 / 114246 | 26 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 5 / 119369 | 41 | ![]() |
germ cell tumor | 5 / 263845 | 18 | ![]() |
glioma | 1 / 106883 | 9 | ![]() |
head and neck tumor | 14 / 136302 | 102 | ![]() |
kidney tumor | 1 / 68959 | 14 | ![]() |
leukemia | 2 / 95842 | 20 | ![]() |
liver tumor | 7 / 96359 | 72 | ![]() |
lung tumor | 3 / 103127 | 29 | ![]() |
lymphoma | 1 / 71755 | 13 | ![]() |
non-neoplasia | 0 / 97250 | 0 | |
normal | 72 / 3360307 | 21 | ![]() |
ovarian tumor | 1 / 76682 | 13 | ![]() |
pancreatic tumor | 1 / 104616 | 9 | ![]() |
primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | ![]() |
prostate cancer | 3 / 102680 | 29 | ![]() |
retinoblastoma | 1 / 46356 | 21 | ![]() |
skin tumor | 2 / 124949 | 16 | ![]() |
soft tissue/muscle tissue tumor | 3 / 125191 | 23 | ![]() |
uterine tumor | 2 / 90257 | 22 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 2 / 33197 | 60 | ![]() |
ascites | 3 / 40015 | 74 | ![]() |
bladder | 0 / 29757 | 0 | |
blood | 2 / 123478 | 16 | ![]() |
bone | 1 / 71655 | 13 | ![]() |
bone marrow | 1 / 48801 | 20 | ![]() |
brain | 3 / 1100989 | 2 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 0 / 149255 | 0 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 2 / 215722 | 9 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 7 / 211054 | 33 | ![]() |
heart | 3 / 89626 | 33 | ![]() |
intestine | 6 / 234472 | 25 | ![]() |
kidney | 4 / 211777 | 18 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 10 / 207743 | 48 | ![]() |
lung | 7 / 336974 | 20 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 5 / 91610 | 54 | ![]() |
mammary gland | 7 / 153271 | 45 | ![]() |
mouth | 14 / 67052 | 208 | ![]() |
muscle | 2 / 107715 | 18 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 1 / 102051 | 9 | ![]() |
pancreas | 6 / 214812 | 27 | ![]() |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 11 / 280825 | 39 | ![]() |
prostate | 4 / 189345 | 21 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 6 / 210574 | 28 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 2 / 96619 | 20 | ![]() |
testis | 3 / 330442 | 9 | ![]() |
thymus | 1 / 81131 | 12 | ![]() |
thyroid | 1 / 47473 | 21 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 8 / 232878 | 34 | ![]() |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202844_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 92.75 | ![]() |
Adipocyte | 53.4 | ![]() |
AdrenalCortex | 56.85 | ![]() |
Adrenalgland | 30.8 | ![]() |
Amygdala | 78.25 | ![]() |
Appendix | 36.65 | ![]() |
AtrioventricularNode | 41.75 | ![]() |
BDCA4+_DentriticCells | 113.55 | ![]() |
Bonemarrow | 31.25 | ![]() |
BronchialEpithelialCells | 77.85 | ![]() |
CD105+_Endothelial | 454.75 | ![]() |
CD14+_Monocytes | 119.75 | ![]() |
CD19+_BCells(neg._sel.) | 136.15 | ![]() |
CD33+_Myeloid | 261.6 | ![]() |
CD34+ | 195.4 | ![]() |
CD4+_Tcells | 60.8 | ![]() |
CD56+_NKCells | 211 | ![]() |
CD71+_EarlyErythroid | 196.7 | ![]() |
CD8+_Tcells | 96.1 | ![]() |
CardiacMyocytes | 53.05 | ![]() |
Caudatenucleus | 24.65 | ![]() |
Cerebellum | 26.2 | ![]() |
CerebellumPeduncles | 50.1 | ![]() |
CiliaryGanglion | 36.05 | ![]() |
CingulateCortex | 82.45 | ![]() |
Colorectaladenocarcinoma | 47.9 | ![]() |
DorsalRootGanglion | 30.45 | ![]() |
FetalThyroid | 39.35 | ![]() |
Fetalbrain | 31.95 | ![]() |
Fetalliver | 34.25 | ![]() |
Fetallung | 23.65 | ![]() |
GlobusPallidus | 30.1 | ![]() |
Heart | 32.05 | ![]() |
Hypothalamus | 41 | ![]() |
Kidney | 29.85 | ![]() |
Leukemia_chronicMyelogenousK-562 | 26 | ![]() |
Leukemia_promyelocytic-HL-60 | 59.95 | ![]() |
Leukemialymphoblastic(MOLT-4) | 34.55 | ![]() |
Liver | 51.55 | ![]() |
Lung | 60.35 | ![]() |
Lymphnode | 25.2 | ![]() |
Lymphoma_burkitts(Daudi) | 40 | ![]() |
Lymphoma_burkitts(Raji) | 36.7 | ![]() |
MedullaOblongata | 49.3 | ![]() |
OccipitalLobe | 43.2 | ![]() |
OlfactoryBulb | 136.25 | ![]() |
Ovary | 23.4 | ![]() |
Pancreas | 31.7 | ![]() |
PancreaticIslet | 44.45 | ![]() |
ParietalLobe | 53.35 | ![]() |
Pituitary | 27.05 | ![]() |
Placenta | 77 | ![]() |
Pons | 35.4 | ![]() |
PrefrontalCortex | 70.15 | ![]() |
Prostate | 204 | ![]() |
Salivarygland | 18.8 | ![]() |
SkeletalMuscle | 58.35 | ![]() |
Skin | 49.75 | ![]() |
SmoothMuscle | 56.7 | ![]() |
Spinalcord | 33.3 | ![]() |
SubthalamicNucleus | 55.15 | ![]() |
SuperiorCervicalGanglion | 54.65 | ![]() |
TemporalLobe | 49.4 | ![]() |
Testis | 30.75 | ![]() |
TestisGermCell | 27.6 | ![]() |
TestisIntersitial | 26.3 | ![]() |
TestisLeydigCell | 34 | ![]() |
TestisSeminiferousTubule | 35 | ![]() |
Thalamus | 26.45 | ![]() |
Thymus | 49.95 | ![]() |
Thyroid | 63.05 | ![]() |
Tongue | 83.9 | ![]() |
Tonsil | 37.9 | ![]() |
Trachea | 24.1 | ![]() |
TrigeminalGanglion | 44.85 | ![]() |
Uterus | 52.65 | ![]() |
UterusCorpus | 40.45 | ![]() |
WholeBlood | 52.7 | ![]() |
Wholebrain | 67.95 | ![]() |
colon | 144.45 | ![]() |
pineal_day | 45.1 | ![]() |
pineal_night | 45.74 | ![]() |
retina | 50.15 | ![]() |
small_intestine | 51.9 | ![]() |
- Probe name: A_24_P230457
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 10.43 ± 0.24 | ![]() ![]() ![]() |
Basal Forebrain | 10.58 ± 0.22 | ![]() ![]() ![]() |
Basal Part of Pons | 10.52 ± 0.17 | ![]() ![]() ![]() |
Cerebellar Cortex | 10.67 ± 0.12 | ![]() ![]() ![]() |
Cerebellar Nuclei | 10.62 ± 0.18 | ![]() ![]() ![]() |
Claustrum | 10.95 ± 0.17 | ![]() ![]() ![]() |
Epithalamus | 10.97 ± 0.24 | ![]() ![]() ![]() |
Frontal Lobe | 10.72 ± 0.22 | ![]() ![]() ![]() |
Globus Pallidus | 10.8 ± 0.27 | ![]() ![]() ![]() |
Hypothalamus | 10.67 ± 0.13 | ![]() ![]() ![]() |
Insula | 10.73 ± 0.12 | ![]() ![]() ![]() |
Limbic Lobe | 10.6 ± 0.25 | ![]() ![]() ![]() |
Mesencephalon | 10.63 ± 0.21 | ![]() ![]() ![]() |
Myelencephalon | 10.62 ± 0.24 | ![]() ![]() ![]() |
Occipital Lobe | 10.45 ± 0.3 | ![]() ![]() ![]() |
Parietal Lobe | 10.73 ± 0.19 | ![]() ![]() ![]() |
Pontine Tegmentum | 10.66 ± 0.25 | ![]() ![]() ![]() |
Striatum | 10.29 ± 0.28 | ![]() ![]() ![]() |
Subthalamus | 10.76 ± 0.18 | ![]() ![]() ![]() |
Temporal Lobe | 10.68 ± 0.17 | ![]() ![]() ![]() |
Thalamus | 10.63 ± 0.22 | ![]() ![]() ![]() |
White Matter | 10.83 ± 0.07 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Ralbp1 | CB | Cerebellum | 3.74 | ![]() |
3.89 | ![]() | |||
Ralbp1 | CTX | Cerebral cortex | 20.63 | ![]() |
10.21 | ![]() | |||
Ralbp1 | HIP | Hippocampal region | 6.75 | ![]() |
4.8 | ![]() | |||
Ralbp1 | HPF | Hippocampal formation | 8.04 | ![]() |
4.79 | ![]() | |||
Ralbp1 | HY | Hypothalamus | 2.7 | ![]() |
1.37 | ![]() | |||
Ralbp1 | LSX | Lateral septal complex | 0.74 | ![]() |
0.68 | ![]() | |||
Ralbp1 | MB | Midbrain | 3.57 | ![]() |
2.58 | ![]() | |||
Ralbp1 | MY | Medulla | 10.16 | ![]() |
6.22 | ![]() | |||
Ralbp1 | OLF | Olfactory bulb | 9.25 | ![]() |
6.19 | ![]() | |||
Ralbp1 | P | Pons | 5.52 | ![]() |
3.07 | ![]() | |||
Ralbp1 | PAL | Pallidum | 4.15 | ![]() |
2.11 | ![]() | |||
Ralbp1 | RHP | Retrohippocampal region | 11.23 | ![]() |
5.1 | ![]() | |||
Ralbp1 | sAMY | Striatum-like amygdalar nuclei | 4.03 | ![]() |
1.43 | ![]() | |||
Ralbp1 | STR | Striatum | 4.22 | ![]() |
2.02 | ![]() | |||
Ralbp1 | STRd | Striatum dorsal region | 4.66 | ![]() |
2.25 | ![]() | |||
Ralbp1 | STRv | Striatum ventral region | 4.94 | ![]() |
2.33 | ![]() | |||
Ralbp1 | TH | Thalamus | 2.42 | ![]() |
1.33 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00133474 | 31 | 170 | 200 | KKPIQEPEVPQIDVPNLKPIFGIPLADAVER | Peptide Atlas |