Annotation Detail for SF3B2


Gene Symbol: | SF3B2 ( Cus1,SAP145,SF3B145,SF3b1,SF3b150 ) |
---|---|
Gene Full Name: | splicing factor 3b, subunit 2, 145kDa |
Band: | 11q13.1 |
Quick Links | Entrez ID:10992; OMIM: 605591; Uniprot ID:SF3B2_HUMAN; ENSEMBL ID: ENSG00000087365; HGNC ID: 10769 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.406423
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 15 / 70761 | 211 | ![]() |
blastocyst | 22 / 62319 | 353 | ![]() |
fetus | 50 / 564012 | 88 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 1 / 23620 | 42 | ![]() |
juvenile | 5 / 55556 | 89 | ![]() |
adult | 379 / 1939121 | 195 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 3 / 12794 | 234 | ![]() |
bladder carcinoma | 3 / 17475 | 171 | ![]() |
breast (mammary gland) tumor | 41 / 94178 | 435 | ![]() |
cervical tumor | 10 / 34366 | 290 | ![]() |
chondrosarcoma | 34 / 82823 | 410 | ![]() |
colorectal tumor | 24 / 114246 | 210 | ![]() |
esophageal tumor | 1 / 17290 | 57 | ![]() |
gastrointestinal tumor | 28 / 119369 | 234 | ![]() |
germ cell tumor | 30 / 263845 | 113 | ![]() |
glioma | 27 / 106883 | 252 | ![]() |
head and neck tumor | 41 / 136302 | 300 | ![]() |
kidney tumor | 24 / 68959 | 348 | ![]() |
leukemia | 32 / 95842 | 333 | ![]() |
liver tumor | 28 / 96359 | 290 | ![]() |
lung tumor | 35 / 103127 | 339 | ![]() |
lymphoma | 14 / 71755 | 195 | ![]() |
non-neoplasia | 9 / 97250 | 92 | ![]() |
normal | 379 / 3360307 | 112 | ![]() |
ovarian tumor | 32 / 76682 | 417 | ![]() |
pancreatic tumor | 26 / 104616 | 248 | ![]() |
primitive neuroectodermal tumor of the CNS | 28 / 125680 | 222 | ![]() |
prostate cancer | 29 / 102680 | 282 | ![]() |
retinoblastoma | 29 / 46356 | 625 | ![]() |
skin tumor | 36 / 124949 | 288 | ![]() |
soft tissue/muscle tissue tumor | 44 / 125191 | 351 | ![]() |
uterine tumor | 21 / 90257 | 232 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 3 / 33197 | 90 | ![]() |
ascites | 5 / 40015 | 124 | ![]() |
bladder | 3 / 29757 | 100 | ![]() |
blood | 22 / 123478 | 178 | ![]() |
bone | 19 / 71655 | 265 | ![]() |
bone marrow | 16 / 48801 | 327 | ![]() |
brain | 113 / 1100989 | 102 | ![]() |
cervix | 15 / 48171 | 311 | ![]() |
connective tissue | 14 / 149255 | 93 | ![]() |
ear | 1 / 16212 | 61 | ![]() |
embryonic tissue | 55 / 215722 | 254 | ![]() |
esophagus | 1 / 20209 | 49 | ![]() |
eye | 73 / 211054 | 345 | ![]() |
heart | 9 / 89626 | 100 | ![]() |
intestine | 42 / 234472 | 179 | ![]() |
kidney | 31 / 211777 | 146 | ![]() |
larynx | 8 / 24145 | 331 | ![]() |
liver | 44 / 207743 | 211 | ![]() |
lung | 77 / 336974 | 228 | ![]() |
lymph | 10 / 44270 | 225 | ![]() |
lymph node | 30 / 91610 | 327 | ![]() |
mammary gland | 49 / 153271 | 319 | ![]() |
mouth | 8 / 67052 | 119 | ![]() |
muscle | 20 / 107715 | 185 | ![]() |
nerve | 3 / 15768 | 190 | ![]() |
ovary | 41 / 102051 | 401 | ![]() |
pancreas | 37 / 214812 | 172 | ![]() |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 1 / 41328 | 24 | ![]() |
pituitary gland | 3 / 16585 | 180 | ![]() |
placenta | 32 / 280825 | 113 | ![]() |
prostate | 38 / 189345 | 200 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 43 / 210574 | 204 | ![]() |
spleen | 3 / 53952 | 55 | ![]() |
stomach | 14 / 96619 | 144 | ![]() |
testis | 50 / 330442 | 151 | ![]() |
thymus | 3 / 81131 | 36 | ![]() |
thyroid | 40 / 47473 | 842 | ![]() |
tonsil | 3 / 16999 | 176 | ![]() |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 52 / 232878 | 223 | ![]() |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 200619_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 691.45 | ![]() |
Adipocyte | 161.35 | ![]() |
AdrenalCortex | 59.75 | ![]() |
Adrenalgland | 111.5 | ![]() |
Amygdala | 110.95 | ![]() |
Appendix | 19.9 | ![]() |
AtrioventricularNode | 7.45 | ![]() |
BDCA4+_DentriticCells | 394.45 | ![]() |
Bonemarrow | 159.25 | ![]() |
BronchialEpithelialCells | 252.05 | ![]() |
CD105+_Endothelial | 254.45 | ![]() |
CD14+_Monocytes | 320.25 | ![]() |
CD19+_BCells(neg._sel.) | 351.65 | ![]() |
CD33+_Myeloid | 260.1 | ![]() |
CD34+ | 393.35 | ![]() |
CD4+_Tcells | 407.35 | ![]() |
CD56+_NKCells | 497.7 | ![]() |
CD71+_EarlyErythroid | 248.95 | ![]() |
CD8+_Tcells | 314.55 | ![]() |
CardiacMyocytes | 230.9 | ![]() |
Caudatenucleus | 152.25 | ![]() |
Cerebellum | 116.95 | ![]() |
CerebellumPeduncles | 187.6 | ![]() |
CiliaryGanglion | 23.65 | ![]() |
CingulateCortex | 132.8 | ![]() |
Colorectaladenocarcinoma | 292.8 | ![]() |
DorsalRootGanglion | 5.1 | ![]() |
FetalThyroid | 248.8 | ![]() |
Fetalbrain | 166.05 | ![]() |
Fetalliver | 144 | ![]() |
Fetallung | 188.3 | ![]() |
GlobusPallidus | 38.1 | ![]() |
Heart | 111.9 | ![]() |
Hypothalamus | 221.95 | ![]() |
Kidney | 91.75 | ![]() |
Leukemia_chronicMyelogenousK-562 | 253.85 | ![]() |
Leukemia_promyelocytic-HL-60 | 179.9 | ![]() |
Leukemialymphoblastic(MOLT-4) | 323.7 | ![]() |
Liver | 177.5 | ![]() |
Lung | 199 | ![]() |
Lymphnode | 144.95 | ![]() |
Lymphoma_burkitts(Daudi) | 274.25 | ![]() |
Lymphoma_burkitts(Raji) | 177.05 | ![]() |
MedullaOblongata | 103.2 | ![]() |
OccipitalLobe | 127.6 | ![]() |
OlfactoryBulb | 132.8 | ![]() |
Ovary | 99.7 | ![]() |
Pancreas | 135.3 | ![]() |
PancreaticIslet | 250.45 | ![]() |
ParietalLobe | 115.1 | ![]() |
Pituitary | 200.95 | ![]() |
Placenta | 218.55 | ![]() |
Pons | 76.6 | ![]() |
PrefrontalCortex | 218.7 | ![]() |
Prostate | 163.65 | ![]() |
Salivarygland | 73.7 | ![]() |
SkeletalMuscle | 59.65 | ![]() |
Skin | 9.65 | ![]() |
SmoothMuscle | 249.25 | ![]() |
Spinalcord | 153.15 | ![]() |
SubthalamicNucleus | 69.85 | ![]() |
SuperiorCervicalGanglion | 9.2 | ![]() |
TemporalLobe | 112.95 | ![]() |
Testis | 381.1 | ![]() |
TestisGermCell | 279.5 | ![]() |
TestisIntersitial | 236.8 | ![]() |
TestisLeydigCell | 168.85 | ![]() |
TestisSeminiferousTubule | 257.85 | ![]() |
Thalamus | 209.05 | ![]() |
Thymus | 249.25 | ![]() |
Thyroid | 152.55 | ![]() |
Tongue | 49.95 | ![]() |
Tonsil | 129.2 | ![]() |
Trachea | 106 | ![]() |
TrigeminalGanglion | 9.85 | ![]() |
Uterus | 124.4 | ![]() |
UterusCorpus | 77.15 | ![]() |
WholeBlood | 303.85 | ![]() |
Wholebrain | 158.4 | ![]() |
colon | 79.6 | ![]() |
pineal_day | 343.08 | ![]() |
pineal_night | 293.34 | ![]() |
retina | 235.025 | ![]() |
small_intestine | 118.35 | ![]() |
- Probe name: CUST_977_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 7.72 ± 0.34 | ![]() ![]() ![]() |
Basal Forebrain | 7.9 ± 0.23 | ![]() ![]() ![]() |
Basal Part of Pons | 8.29 ± 0.27 | ![]() ![]() ![]() |
Cerebellar Cortex | 8.07 ± 0.31 | ![]() ![]() ![]() |
Cerebellar Nuclei | 7.87 ± 0.27 | ![]() ![]() ![]() |
Claustrum | 7.54 ± 0.46 | ![]() ![]() ![]() |
Epithalamus | 8.27 ± 0.37 | ![]() ![]() ![]() |
Frontal Lobe | 8.01 ± 0.37 | ![]() ![]() ![]() |
Globus Pallidus | 7.98 ± 0.07 | ![]() ![]() ![]() |
Hypothalamus | 8.08 ± 0.29 | ![]() ![]() ![]() |
Insula | 7.99 ± 0.26 | ![]() ![]() ![]() |
Limbic Lobe | 7.82 ± 0.42 | ![]() ![]() ![]() |
Mesencephalon | 7.79 ± 0.29 | ![]() ![]() ![]() |
Myelencephalon | 7.91 ± 0.36 | ![]() ![]() ![]() |
Occipital Lobe | 7.67 ± 0.34 | ![]() ![]() ![]() |
Parietal Lobe | 7.9 ± 0.32 | ![]() ![]() ![]() |
Pontine Tegmentum | 7.89 ± 0.28 | ![]() ![]() ![]() |
Striatum | 7.96 ± 0.35 | ![]() ![]() ![]() |
Subthalamus | 7.81 ± 0.26 | ![]() ![]() ![]() |
Temporal Lobe | 8.03 ± 0.28 | ![]() ![]() ![]() |
Thalamus | 7.93 ± 0.28 | ![]() ![]() ![]() |
White Matter | 8.71 ± 0.27 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Sf3b2 | CB | Cerebellum | 39.54 | ![]() |
81.01 | ![]() | |||
Sf3b2 | CTX | Cerebral cortex | 100 | ![]() |
100 | ![]() | |||
Sf3b2 | HIP | Hippocampal region | 100 | ![]() |
100 | ![]() | |||
Sf3b2 | HPF | Hippocampal formation | 100 | ![]() |
100 | ![]() | |||
Sf3b2 | HY | Hypothalamus | 84.88 | ![]() |
84.68 | ![]() | |||
Sf3b2 | LSX | Lateral septal complex | 100 | ![]() |
100 | ![]() | |||
Sf3b2 | MB | Midbrain | 89.59 | ![]() |
100 | ![]() | |||
Sf3b2 | MY | Medulla | 81.93 | ![]() |
100 | ![]() | |||
Sf3b2 | OLF | Olfactory bulb | 99.7 | ![]() |
100 | ![]() | |||
Sf3b2 | P | Pons | 76.68 | ![]() |
100 | ![]() | |||
Sf3b2 | PAL | Pallidum | 81.34 | ![]() |
93.08 | ![]() | |||
Sf3b2 | RHP | Retrohippocampal region | 100 | ![]() |
100 | ![]() | |||
Sf3b2 | sAMY | Striatum-like amygdalar nuclei | 100 | ![]() |
100 | ![]() | |||
Sf3b2 | STR | Striatum | 100 | ![]() |
100 | ![]() | |||
Sf3b2 | STRd | Striatum dorsal region | 100 | ![]() |
100 | ![]() | |||
Sf3b2 | STRv | Striatum ventral region | 100 | ![]() |
96.06 | ![]() | |||
Sf3b2 | TH | Thalamus | 100 | ![]() |
100 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00010497 | 31 | 650 | 680 | IPGLNSPIPESCSFGYHAGGWGKPPVDETGK | Peptide Atlas |
SF3B2_HUMAN_126 | 15 | 126 | 140 | LAQQQAALLMQQEER | PRIDE |
SF3B2_HUMAN_225 | 11 | 225 | 235 | GPPPPPGDENR | PRIDE |
SF3B2_HUMAN_261 | 18 | 261 | 278 | QEEMNSQQEEEEMETDAR | PRIDE |
SF3B2_HUMAN_292 | 11 | 292 | 302 | TVSVSKKEKNR | PRIDE |
SF3B2_HUMAN_37 | 12 | 37 | 48 | QTGIVLNRPVLR | PRIDE |
SF3B2_HUMAN_444 | 20 | 444 | 463 | QLVARPDVVEMHDVTAQDPK | PRIDE |
SF3B2_HUMAN_444 | 29 | 444 | 472 | QLVARPDVVEMHDVTAQDPKLLVHLKATR | PRIDE |
SF3B2_HUMAN_592 | 13 | 592 | 604 | ISLGMPVGPNAHK | PRIDE |