Annotation Detail for SF3B2
Basic Information Top
| Gene Symbol: | SF3B2 ( Cus1,SAP145,SF3B145,SF3b1,SF3b150 ) |
|---|---|
| Gene Full Name: | splicing factor 3b, subunit 2, 145kDa |
| Band: | 11q13.1 |
| Quick Links | Entrez ID:10992; OMIM: 605591; Uniprot ID:SF3B2_HUMAN; ENSEMBL ID: ENSG00000087365; HGNC ID: 10769 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.406423
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 15 / 70761 | 211 | |
| blastocyst | 22 / 62319 | 353 | |
| fetus | 50 / 564012 | 88 | |
| neonate | 0 / 31097 | 0 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 5 / 55556 | 89 | |
| adult | 379 / 1939121 | 195 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 3 / 12794 | 234 | |
| bladder carcinoma | 3 / 17475 | 171 | |
| breast (mammary gland) tumor | 41 / 94178 | 435 | |
| cervical tumor | 10 / 34366 | 290 | |
| chondrosarcoma | 34 / 82823 | 410 | |
| colorectal tumor | 24 / 114246 | 210 | |
| esophageal tumor | 1 / 17290 | 57 | |
| gastrointestinal tumor | 28 / 119369 | 234 | |
| germ cell tumor | 30 / 263845 | 113 | |
| glioma | 27 / 106883 | 252 | |
| head and neck tumor | 41 / 136302 | 300 | |
| kidney tumor | 24 / 68959 | 348 | |
| leukemia | 32 / 95842 | 333 | |
| liver tumor | 28 / 96359 | 290 | |
| lung tumor | 35 / 103127 | 339 | |
| lymphoma | 14 / 71755 | 195 | |
| non-neoplasia | 9 / 97250 | 92 | |
| normal | 379 / 3360307 | 112 | |
| ovarian tumor | 32 / 76682 | 417 | |
| pancreatic tumor | 26 / 104616 | 248 | |
| primitive neuroectodermal tumor of the CNS | 28 / 125680 | 222 | |
| prostate cancer | 29 / 102680 | 282 | |
| retinoblastoma | 29 / 46356 | 625 | |
| skin tumor | 36 / 124949 | 288 | |
| soft tissue/muscle tissue tumor | 44 / 125191 | 351 | |
| uterine tumor | 21 / 90257 | 232 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 3 / 33197 | 90 | |
| ascites | 5 / 40015 | 124 | |
| bladder | 3 / 29757 | 100 | |
| blood | 22 / 123478 | 178 | |
| bone | 19 / 71655 | 265 | |
| bone marrow | 16 / 48801 | 327 | |
| brain | 113 / 1100989 | 102 | |
| cervix | 15 / 48171 | 311 | |
| connective tissue | 14 / 149255 | 93 | |
| ear | 1 / 16212 | 61 | |
| embryonic tissue | 55 / 215722 | 254 | |
| esophagus | 1 / 20209 | 49 | |
| eye | 73 / 211054 | 345 | |
| heart | 9 / 89626 | 100 | |
| intestine | 42 / 234472 | 179 | |
| kidney | 31 / 211777 | 146 | |
| larynx | 8 / 24145 | 331 | |
| liver | 44 / 207743 | 211 | |
| lung | 77 / 336974 | 228 | |
| lymph | 10 / 44270 | 225 | |
| lymph node | 30 / 91610 | 327 | |
| mammary gland | 49 / 153271 | 319 | |
| mouth | 8 / 67052 | 119 | |
| muscle | 20 / 107715 | 185 | |
| nerve | 3 / 15768 | 190 | |
| ovary | 41 / 102051 | 401 | |
| pancreas | 37 / 214812 | 172 | |
| parathyroid | 1 / 20539 | 48 | |
| pharynx | 1 / 41328 | 24 | |
| pituitary gland | 3 / 16585 | 180 | |
| placenta | 32 / 280825 | 113 | |
| prostate | 38 / 189345 | 200 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 43 / 210574 | 204 | |
| spleen | 3 / 53952 | 55 | |
| stomach | 14 / 96619 | 144 | |
| testis | 50 / 330442 | 151 | |
| thymus | 3 / 81131 | 36 | |
| thyroid | 40 / 47473 | 842 | |
| tonsil | 3 / 16999 | 176 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 52 / 232878 | 223 | |
| vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 200619_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 691.45 | |
| Adipocyte | 161.35 | |
| AdrenalCortex | 59.75 | |
| Adrenalgland | 111.5 | |
| Amygdala | 110.95 | |
| Appendix | 19.9 | |
| AtrioventricularNode | 7.45 | |
| BDCA4+_DentriticCells | 394.45 | |
| Bonemarrow | 159.25 | |
| BronchialEpithelialCells | 252.05 | |
| CD105+_Endothelial | 254.45 | |
| CD14+_Monocytes | 320.25 | |
| CD19+_BCells(neg._sel.) | 351.65 | |
| CD33+_Myeloid | 260.1 | |
| CD34+ | 393.35 | |
| CD4+_Tcells | 407.35 | |
| CD56+_NKCells | 497.7 | |
| CD71+_EarlyErythroid | 248.95 | |
| CD8+_Tcells | 314.55 | |
| CardiacMyocytes | 230.9 | |
| Caudatenucleus | 152.25 | |
| Cerebellum | 116.95 | |
| CerebellumPeduncles | 187.6 | |
| CiliaryGanglion | 23.65 | |
| CingulateCortex | 132.8 | |
| Colorectaladenocarcinoma | 292.8 | |
| DorsalRootGanglion | 5.1 | |
| FetalThyroid | 248.8 | |
| Fetalbrain | 166.05 | |
| Fetalliver | 144 | |
| Fetallung | 188.3 | |
| GlobusPallidus | 38.1 | |
| Heart | 111.9 | |
| Hypothalamus | 221.95 | |
| Kidney | 91.75 | |
| Leukemia_chronicMyelogenousK-562 | 253.85 | |
| Leukemia_promyelocytic-HL-60 | 179.9 | |
| Leukemialymphoblastic(MOLT-4) | 323.7 | |
| Liver | 177.5 | |
| Lung | 199 | |
| Lymphnode | 144.95 | |
| Lymphoma_burkitts(Daudi) | 274.25 | |
| Lymphoma_burkitts(Raji) | 177.05 | |
| MedullaOblongata | 103.2 | |
| OccipitalLobe | 127.6 | |
| OlfactoryBulb | 132.8 | |
| Ovary | 99.7 | |
| Pancreas | 135.3 | |
| PancreaticIslet | 250.45 | |
| ParietalLobe | 115.1 | |
| Pituitary | 200.95 | |
| Placenta | 218.55 | |
| Pons | 76.6 | |
| PrefrontalCortex | 218.7 | |
| Prostate | 163.65 | |
| Salivarygland | 73.7 | |
| SkeletalMuscle | 59.65 | |
| Skin | 9.65 | |
| SmoothMuscle | 249.25 | |
| Spinalcord | 153.15 | |
| SubthalamicNucleus | 69.85 | |
| SuperiorCervicalGanglion | 9.2 | |
| TemporalLobe | 112.95 | |
| Testis | 381.1 | |
| TestisGermCell | 279.5 | |
| TestisIntersitial | 236.8 | |
| TestisLeydigCell | 168.85 | |
| TestisSeminiferousTubule | 257.85 | |
| Thalamus | 209.05 | |
| Thymus | 249.25 | |
| Thyroid | 152.55 | |
| Tongue | 49.95 | |
| Tonsil | 129.2 | |
| Trachea | 106 | |
| TrigeminalGanglion | 9.85 | |
| Uterus | 124.4 | |
| UterusCorpus | 77.15 | |
| WholeBlood | 303.85 | |
| Wholebrain | 158.4 | |
| colon | 79.6 | |
| pineal_day | 343.08 | |
| pineal_night | 293.34 | |
| retina | 235.025 | |
| small_intestine | 118.35 |
- Probe name: CUST_977_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 7.72 ± 0.34 | |
| Basal Forebrain | 7.9 ± 0.23 | |
| Basal Part of Pons | 8.29 ± 0.27 | |
| Cerebellar Cortex | 8.07 ± 0.31 | |
| Cerebellar Nuclei | 7.87 ± 0.27 | |
| Claustrum | 7.54 ± 0.46 | |
| Epithalamus | 8.27 ± 0.37 | |
| Frontal Lobe | 8.01 ± 0.37 | |
| Globus Pallidus | 7.98 ± 0.07 | |
| Hypothalamus | 8.08 ± 0.29 | |
| Insula | 7.99 ± 0.26 | |
| Limbic Lobe | 7.82 ± 0.42 | |
| Mesencephalon | 7.79 ± 0.29 | |
| Myelencephalon | 7.91 ± 0.36 | |
| Occipital Lobe | 7.67 ± 0.34 | |
| Parietal Lobe | 7.9 ± 0.32 | |
| Pontine Tegmentum | 7.89 ± 0.28 | |
| Striatum | 7.96 ± 0.35 | |
| Subthalamus | 7.81 ± 0.26 | |
| Temporal Lobe | 8.03 ± 0.28 | |
| Thalamus | 7.93 ± 0.28 | |
| White Matter | 8.71 ± 0.27 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Sf3b2 | CB | Cerebellum | 39.54 | |
| 81.01 | ||||
| Sf3b2 | CTX | Cerebral cortex | 100 | |
| 100 | ||||
| Sf3b2 | HIP | Hippocampal region | 100 | |
| 100 | ||||
| Sf3b2 | HPF | Hippocampal formation | 100 | |
| 100 | ||||
| Sf3b2 | HY | Hypothalamus | 84.88 | |
| 84.68 | ||||
| Sf3b2 | LSX | Lateral septal complex | 100 | |
| 100 | ||||
| Sf3b2 | MB | Midbrain | 89.59 | |
| 100 | ||||
| Sf3b2 | MY | Medulla | 81.93 | |
| 100 | ||||
| Sf3b2 | OLF | Olfactory bulb | 99.7 | |
| 100 | ||||
| Sf3b2 | P | Pons | 76.68 | |
| 100 | ||||
| Sf3b2 | PAL | Pallidum | 81.34 | |
| 93.08 | ||||
| Sf3b2 | RHP | Retrohippocampal region | 100 | |
| 100 | ||||
| Sf3b2 | sAMY | Striatum-like amygdalar nuclei | 100 | |
| 100 | ||||
| Sf3b2 | STR | Striatum | 100 | |
| 100 | ||||
| Sf3b2 | STRd | Striatum dorsal region | 100 | |
| 100 | ||||
| Sf3b2 | STRv | Striatum ventral region | 100 | |
| 96.06 | ||||
| Sf3b2 | TH | Thalamus | 100 | |
| 100 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00010497 | 31 | 650 | 680 | IPGLNSPIPESCSFGYHAGGWGKPPVDETGK | Peptide Atlas |
| SF3B2_HUMAN_126 | 15 | 126 | 140 | LAQQQAALLMQQEER | PRIDE |
| SF3B2_HUMAN_225 | 11 | 225 | 235 | GPPPPPGDENR | PRIDE |
| SF3B2_HUMAN_261 | 18 | 261 | 278 | QEEMNSQQEEEEMETDAR | PRIDE |
| SF3B2_HUMAN_292 | 11 | 292 | 302 | TVSVSKKEKNR | PRIDE |
| SF3B2_HUMAN_37 | 12 | 37 | 48 | QTGIVLNRPVLR | PRIDE |
| SF3B2_HUMAN_444 | 20 | 444 | 463 | QLVARPDVVEMHDVTAQDPK | PRIDE |
| SF3B2_HUMAN_444 | 29 | 444 | 472 | QLVARPDVVEMHDVTAQDPKLLVHLKATR | PRIDE |
| SF3B2_HUMAN_592 | 13 | 592 | 604 | ISLGMPVGPNAHK | PRIDE |



