Annotation Detail for SLC27A3
Basic Information Top
| Gene Symbol: | SLC27A3 ( ACSVL3,FATP3,MGC4365,VLCS-3 ) |
|---|---|
| Gene Full Name: | solute carrier family 27 (fatty acid transporter), member 3 |
| Band: | 1q21.3 |
| Quick Links | Entrez ID:11000; OMIM: 604193; Uniprot ID:S27A3_HUMAN; ENSEMBL ID: ENSG00000143554; HGNC ID: 10997 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.438723
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 2 / 70761 | 28 | |
| blastocyst | 4 / 62319 | 64 | |
| fetus | 19 / 564012 | 33 | |
| neonate | 1 / 31097 | 32 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 65 / 1939121 | 33 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 1 / 94178 | 10 | |
| cervical tumor | 3 / 34366 | 87 | |
| chondrosarcoma | 1 / 82823 | 12 | |
| colorectal tumor | 4 / 114246 | 35 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 4 / 119369 | 33 | |
| germ cell tumor | 14 / 263845 | 53 | |
| glioma | 1 / 106883 | 9 | |
| head and neck tumor | 3 / 136302 | 22 | |
| kidney tumor | 3 / 68959 | 43 | |
| leukemia | 5 / 95842 | 52 | |
| liver tumor | 1 / 96359 | 10 | |
| lung tumor | 7 / 103127 | 67 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 15 / 97250 | 154 | |
| normal | 142 / 3360307 | 42 | |
| ovarian tumor | 3 / 76682 | 39 | |
| pancreatic tumor | 0 / 104616 | 0 | |
| primitive neuroectodermal tumor of the CNS | 8 / 125680 | 63 | |
| prostate cancer | 0 / 102680 | 0 | |
| retinoblastoma | 3 / 46356 | 64 | |
| skin tumor | 21 / 124949 | 168 | |
| soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
| uterine tumor | 5 / 90257 | 55 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 2 / 13106 | 152 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 0 / 29757 | 0 | |
| blood | 11 / 123478 | 89 | |
| bone | 1 / 71655 | 13 | |
| bone marrow | 4 / 48801 | 81 | |
| brain | 40 / 1100989 | 36 | |
| cervix | 5 / 48171 | 103 | |
| connective tissue | 11 / 149255 | 73 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 7 / 215722 | 32 | |
| esophagus | 1 / 20209 | 49 | |
| eye | 15 / 211054 | 71 | |
| heart | 2 / 89626 | 22 | |
| intestine | 8 / 234472 | 34 | |
| kidney | 11 / 211777 | 51 | |
| larynx | 0 / 24145 | 0 | |
| liver | 1 / 207743 | 4 | |
| lung | 21 / 336974 | 62 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 3 / 91610 | 32 | |
| mammary gland | 2 / 153271 | 13 | |
| mouth | 4 / 67052 | 59 | |
| muscle | 0 / 107715 | 0 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 5 / 102051 | 48 | |
| pancreas | 0 / 214812 | 0 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 17 / 280825 | 60 | |
| prostate | 10 / 189345 | 52 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 24 / 210574 | 113 | |
| spleen | 4 / 53952 | 74 | |
| stomach | 4 / 96619 | 41 | |
| testis | 16 / 330442 | 48 | |
| thymus | 3 / 81131 | 36 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 4 / 52413 | 76 | |
| umbilical cord | 1 / 13680 | 73 | |
| uterus | 13 / 232878 | 55 | |
| vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202809_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 330 | |
| Adipocyte | 99.55 | |
| AdrenalCortex | 135.4 | |
| Adrenalgland | 109.2 | |
| Amygdala | 105.4 | |
| Appendix | 46.8 | |
| AtrioventricularNode | 78.5 | |
| BDCA4+_DentriticCells | 316.35 | |
| Bonemarrow | 81.55 | |
| BronchialEpithelialCells | 82.3 | |
| CD105+_Endothelial | 248.05 | |
| CD14+_Monocytes | 251.65 | |
| CD19+_BCells(neg._sel.) | 214.55 | |
| CD33+_Myeloid | 400.7 | |
| CD34+ | 555.25 | |
| CD4+_Tcells | 437.6 | |
| CD56+_NKCells | 199.6 | |
| CD71+_EarlyErythroid | 77.85 | |
| CD8+_Tcells | 425.15 | |
| CardiacMyocytes | 71.1 | |
| Caudatenucleus | 76.9 | |
| Cerebellum | 87.2 | |
| CerebellumPeduncles | 143.15 | |
| CiliaryGanglion | 69.85 | |
| CingulateCortex | 90.95 | |
| Colorectaladenocarcinoma | 61.95 | |
| DorsalRootGanglion | 69.4 | |
| FetalThyroid | 125.15 | |
| Fetalbrain | 213.85 | |
| Fetalliver | 61.55 | |
| Fetallung | 116.4 | |
| GlobusPallidus | 72.1 | |
| Heart | 109.8 | |
| Hypothalamus | 169.45 | |
| Kidney | 78.9 | |
| Leukemia_chronicMyelogenousK-562 | 78.1 | |
| Leukemia_promyelocytic-HL-60 | 88.9 | |
| Leukemialymphoblastic(MOLT-4) | 72.2 | |
| Liver | 87.3 | |
| Lung | 137.3 | |
| Lymphnode | 156.85 | |
| Lymphoma_burkitts(Daudi) | 103.35 | |
| Lymphoma_burkitts(Raji) | 120.7 | |
| MedullaOblongata | 99 | |
| OccipitalLobe | 101.9 | |
| OlfactoryBulb | 137.5 | |
| Ovary | 77.7 | |
| Pancreas | 78.8 | |
| PancreaticIslet | 87.05 | |
| ParietalLobe | 88.55 | |
| Pituitary | 127.5 | |
| Placenta | 90.1 | |
| Pons | 81.6 | |
| PrefrontalCortex | 221.15 | |
| Prostate | 170.35 | |
| Salivarygland | 69.2 | |
| SkeletalMuscle | 82.75 | |
| Skin | 66.4 | |
| SmoothMuscle | 78.05 | |
| Spinalcord | 118.65 | |
| SubthalamicNucleus | 91.35 | |
| SuperiorCervicalGanglion | 98.65 | |
| TemporalLobe | 61.45 | |
| Testis | 100.5 | |
| TestisGermCell | 161.4 | |
| TestisIntersitial | 124.35 | |
| TestisLeydigCell | 132.2 | |
| TestisSeminiferousTubule | 201.7 | |
| Thalamus | 88 | |
| Thymus | 139.1 | |
| Thyroid | 85.55 | |
| Tongue | 89 | |
| Tonsil | 88.85 | |
| Trachea | 71.25 | |
| TrigeminalGanglion | 104.5 | |
| Uterus | 163.45 | |
| UterusCorpus | 81.65 | |
| WholeBlood | 122.9 | |
| Wholebrain | 116.8 | |
| colon | 71.65 | |
| pineal_day | 357.12 | |
| pineal_night | 316.18 | |
| retina | 154.6 | |
| small_intestine | 69.1 |
- Probe name: CUST_724_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 3.59 ± 0.66 | |
| Basal Forebrain | 3.53 ± 0.59 | |
| Basal Part of Pons | 3.28 ± 0.62 | |
| Cerebellar Cortex | 3.64 ± 0.64 | |
| Cerebellar Nuclei | 3.64 ± 0.81 | |
| Claustrum | 3.45 ± 0.76 | |
| Epithalamus | 3.31 ± 0.28 | |
| Frontal Lobe | 3.43 ± 0.73 | |
| Globus Pallidus | 2.75 ± 1.12 | |
| Hypothalamus | 3.49 ± 0.72 | |
| Insula | 3.5 ± 0.48 | |
| Limbic Lobe | 3.33 ± 0.65 | |
| Mesencephalon | 3.42 ± 0.6 | |
| Myelencephalon | 3.42 ± 0.71 | |
| Occipital Lobe | 3.22 ± 0.68 | |
| Parietal Lobe | 3.33 ± 0.59 | |
| Pontine Tegmentum | 3.36 ± 0.73 | |
| Striatum | 3.17 ± 0.67 | |
| Subthalamus | 2.91 ± 0.22 | |
| Temporal Lobe | 3.41 ± 0.61 | |
| Thalamus | 3.38 ± 0.59 | |
| White Matter | 2.9 ± 0.75 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Slc27a3 | CB | Cerebellum | 4.94 | |
| 5.53 | ||||
| Slc27a3 | CTX | Cerebral cortex | 6.69 | |
| 5.37 | ||||
| Slc27a3 | HIP | Hippocampal region | 10.58 | |
| 10.3 | ||||
| Slc27a3 | HPF | Hippocampal formation | 9.47 | |
| 8.99 | ||||
| Slc27a3 | HY | Hypothalamus | 1.47 | |
| 0.98 | ||||
| Slc27a3 | LSX | Lateral septal complex | 1.11 | |
| 1.23 | ||||
| Slc27a3 | MB | Midbrain | 3.83 | |
| 3.79 | ||||
| Slc27a3 | MY | Medulla | 3.16 | |
| 2.99 | ||||
| Slc27a3 | OLF | Olfactory bulb | 7.78 | |
| 6.15 | ||||
| Slc27a3 | P | Pons | 7.33 | |
| 7.13 | ||||
| Slc27a3 | PAL | Pallidum | 0.83 | |
| 0.78 | ||||
| Slc27a3 | RHP | Retrohippocampal region | 7.79 | |
| 7.23 | ||||
| Slc27a3 | sAMY | Striatum-like amygdalar nuclei | 1.57 | |
| 1.45 | ||||
| Slc27a3 | STR | Striatum | 1.08 | |
| 1.04 | ||||
| Slc27a3 | STRd | Striatum dorsal region | 1.15 | |
| 1.2 | ||||
| Slc27a3 | STRv | Striatum ventral region | 0.69 | |
| 0.4 | ||||
| Slc27a3 | TH | Thalamus | 4.14 | |
| 3.32 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00095622 | 25 | 643 | 667 | DVFRPGDVFFNTGDLLVCDDQGFLR | Peptide Atlas |
| S27A3_HUMAN_0 | 0 | 0 | 0 | ALVLAPEFLESLEPDLPALR | PRIDE |
| S27A3_HUMAN_0 | 0 | 0 | 0 | LAVGSGLRPDTWER | PRIDE |
| S27A3_HUMAN_0 | 0 | 0 | 0 | LQESLATTETFK | PRIDE |
| S27A3_HUMAN_0 | 0 | 0 | 0 | MANEGFDPSTLSDPLYVLDQAVGAYLPLTTAR | PRIDE |
| S27A3_HUMAN_0 | 0 | 0 | 0 | VTVFQYIGELCR | PRIDE |



