Annotation Detail for SLC27A3


Gene Symbol: | SLC27A3 ( ACSVL3,FATP3,MGC4365,VLCS-3 ) |
---|---|
Gene Full Name: | solute carrier family 27 (fatty acid transporter), member 3 |
Band: | 1q21.3 |
Quick Links | Entrez ID:11000; OMIM: 604193; Uniprot ID:S27A3_HUMAN; ENSEMBL ID: ENSG00000143554; HGNC ID: 10997 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.438723
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 2 / 70761 | 28 | ![]() |
blastocyst | 4 / 62319 | 64 | ![]() |
fetus | 19 / 564012 | 33 | ![]() |
neonate | 1 / 31097 | 32 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 1 / 55556 | 17 | ![]() |
adult | 65 / 1939121 | 33 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | ![]() |
cervical tumor | 3 / 34366 | 87 | ![]() |
chondrosarcoma | 1 / 82823 | 12 | ![]() |
colorectal tumor | 4 / 114246 | 35 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 4 / 119369 | 33 | ![]() |
germ cell tumor | 14 / 263845 | 53 | ![]() |
glioma | 1 / 106883 | 9 | ![]() |
head and neck tumor | 3 / 136302 | 22 | ![]() |
kidney tumor | 3 / 68959 | 43 | ![]() |
leukemia | 5 / 95842 | 52 | ![]() |
liver tumor | 1 / 96359 | 10 | ![]() |
lung tumor | 7 / 103127 | 67 | ![]() |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 15 / 97250 | 154 | ![]() |
normal | 142 / 3360307 | 42 | ![]() |
ovarian tumor | 3 / 76682 | 39 | ![]() |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 8 / 125680 | 63 | ![]() |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 3 / 46356 | 64 | ![]() |
skin tumor | 21 / 124949 | 168 | ![]() |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 5 / 90257 | 55 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 2 / 13106 | 152 | ![]() |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 11 / 123478 | 89 | ![]() |
bone | 1 / 71655 | 13 | ![]() |
bone marrow | 4 / 48801 | 81 | ![]() |
brain | 40 / 1100989 | 36 | ![]() |
cervix | 5 / 48171 | 103 | ![]() |
connective tissue | 11 / 149255 | 73 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 7 / 215722 | 32 | ![]() |
esophagus | 1 / 20209 | 49 | ![]() |
eye | 15 / 211054 | 71 | ![]() |
heart | 2 / 89626 | 22 | ![]() |
intestine | 8 / 234472 | 34 | ![]() |
kidney | 11 / 211777 | 51 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 1 / 207743 | 4 | ![]() |
lung | 21 / 336974 | 62 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 3 / 91610 | 32 | ![]() |
mammary gland | 2 / 153271 | 13 | ![]() |
mouth | 4 / 67052 | 59 | ![]() |
muscle | 0 / 107715 | 0 | |
nerve | 1 / 15768 | 63 | ![]() |
ovary | 5 / 102051 | 48 | ![]() |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 17 / 280825 | 60 | ![]() |
prostate | 10 / 189345 | 52 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 24 / 210574 | 113 | ![]() |
spleen | 4 / 53952 | 74 | ![]() |
stomach | 4 / 96619 | 41 | ![]() |
testis | 16 / 330442 | 48 | ![]() |
thymus | 3 / 81131 | 36 | ![]() |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 4 / 52413 | 76 | ![]() |
umbilical cord | 1 / 13680 | 73 | ![]() |
uterus | 13 / 232878 | 55 | ![]() |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202809_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 330 | ![]() |
Adipocyte | 99.55 | ![]() |
AdrenalCortex | 135.4 | ![]() |
Adrenalgland | 109.2 | ![]() |
Amygdala | 105.4 | ![]() |
Appendix | 46.8 | ![]() |
AtrioventricularNode | 78.5 | ![]() |
BDCA4+_DentriticCells | 316.35 | ![]() |
Bonemarrow | 81.55 | ![]() |
BronchialEpithelialCells | 82.3 | ![]() |
CD105+_Endothelial | 248.05 | ![]() |
CD14+_Monocytes | 251.65 | ![]() |
CD19+_BCells(neg._sel.) | 214.55 | ![]() |
CD33+_Myeloid | 400.7 | ![]() |
CD34+ | 555.25 | ![]() |
CD4+_Tcells | 437.6 | ![]() |
CD56+_NKCells | 199.6 | ![]() |
CD71+_EarlyErythroid | 77.85 | ![]() |
CD8+_Tcells | 425.15 | ![]() |
CardiacMyocytes | 71.1 | ![]() |
Caudatenucleus | 76.9 | ![]() |
Cerebellum | 87.2 | ![]() |
CerebellumPeduncles | 143.15 | ![]() |
CiliaryGanglion | 69.85 | ![]() |
CingulateCortex | 90.95 | ![]() |
Colorectaladenocarcinoma | 61.95 | ![]() |
DorsalRootGanglion | 69.4 | ![]() |
FetalThyroid | 125.15 | ![]() |
Fetalbrain | 213.85 | ![]() |
Fetalliver | 61.55 | ![]() |
Fetallung | 116.4 | ![]() |
GlobusPallidus | 72.1 | ![]() |
Heart | 109.8 | ![]() |
Hypothalamus | 169.45 | ![]() |
Kidney | 78.9 | ![]() |
Leukemia_chronicMyelogenousK-562 | 78.1 | ![]() |
Leukemia_promyelocytic-HL-60 | 88.9 | ![]() |
Leukemialymphoblastic(MOLT-4) | 72.2 | ![]() |
Liver | 87.3 | ![]() |
Lung | 137.3 | ![]() |
Lymphnode | 156.85 | ![]() |
Lymphoma_burkitts(Daudi) | 103.35 | ![]() |
Lymphoma_burkitts(Raji) | 120.7 | ![]() |
MedullaOblongata | 99 | ![]() |
OccipitalLobe | 101.9 | ![]() |
OlfactoryBulb | 137.5 | ![]() |
Ovary | 77.7 | ![]() |
Pancreas | 78.8 | ![]() |
PancreaticIslet | 87.05 | ![]() |
ParietalLobe | 88.55 | ![]() |
Pituitary | 127.5 | ![]() |
Placenta | 90.1 | ![]() |
Pons | 81.6 | ![]() |
PrefrontalCortex | 221.15 | ![]() |
Prostate | 170.35 | ![]() |
Salivarygland | 69.2 | ![]() |
SkeletalMuscle | 82.75 | ![]() |
Skin | 66.4 | ![]() |
SmoothMuscle | 78.05 | ![]() |
Spinalcord | 118.65 | ![]() |
SubthalamicNucleus | 91.35 | ![]() |
SuperiorCervicalGanglion | 98.65 | ![]() |
TemporalLobe | 61.45 | ![]() |
Testis | 100.5 | ![]() |
TestisGermCell | 161.4 | ![]() |
TestisIntersitial | 124.35 | ![]() |
TestisLeydigCell | 132.2 | ![]() |
TestisSeminiferousTubule | 201.7 | ![]() |
Thalamus | 88 | ![]() |
Thymus | 139.1 | ![]() |
Thyroid | 85.55 | ![]() |
Tongue | 89 | ![]() |
Tonsil | 88.85 | ![]() |
Trachea | 71.25 | ![]() |
TrigeminalGanglion | 104.5 | ![]() |
Uterus | 163.45 | ![]() |
UterusCorpus | 81.65 | ![]() |
WholeBlood | 122.9 | ![]() |
Wholebrain | 116.8 | ![]() |
colon | 71.65 | ![]() |
pineal_day | 357.12 | ![]() |
pineal_night | 316.18 | ![]() |
retina | 154.6 | ![]() |
small_intestine | 69.1 | ![]() |
- Probe name: CUST_724_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.59 ± 0.66 | ![]() ![]() ![]() |
Basal Forebrain | 3.53 ± 0.59 | ![]() ![]() ![]() |
Basal Part of Pons | 3.28 ± 0.62 | ![]() ![]() ![]() |
Cerebellar Cortex | 3.64 ± 0.64 | ![]() ![]() ![]() |
Cerebellar Nuclei | 3.64 ± 0.81 | ![]() ![]() ![]() |
Claustrum | 3.45 ± 0.76 | ![]() ![]() ![]() |
Epithalamus | 3.31 ± 0.28 | ![]() ![]() ![]() |
Frontal Lobe | 3.43 ± 0.73 | ![]() ![]() ![]() |
Globus Pallidus | 2.75 ± 1.12 | ![]() ![]() ![]() |
Hypothalamus | 3.49 ± 0.72 | ![]() ![]() ![]() |
Insula | 3.5 ± 0.48 | ![]() ![]() ![]() |
Limbic Lobe | 3.33 ± 0.65 | ![]() ![]() ![]() |
Mesencephalon | 3.42 ± 0.6 | ![]() ![]() ![]() |
Myelencephalon | 3.42 ± 0.71 | ![]() ![]() ![]() |
Occipital Lobe | 3.22 ± 0.68 | ![]() ![]() ![]() |
Parietal Lobe | 3.33 ± 0.59 | ![]() ![]() ![]() |
Pontine Tegmentum | 3.36 ± 0.73 | ![]() ![]() ![]() |
Striatum | 3.17 ± 0.67 | ![]() ![]() ![]() |
Subthalamus | 2.91 ± 0.22 | ![]() ![]() ![]() |
Temporal Lobe | 3.41 ± 0.61 | ![]() ![]() ![]() |
Thalamus | 3.38 ± 0.59 | ![]() ![]() ![]() |
White Matter | 2.9 ± 0.75 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Slc27a3 | CB | Cerebellum | 4.94 | ![]() |
5.53 | ![]() | |||
Slc27a3 | CTX | Cerebral cortex | 6.69 | ![]() |
5.37 | ![]() | |||
Slc27a3 | HIP | Hippocampal region | 10.58 | ![]() |
10.3 | ![]() | |||
Slc27a3 | HPF | Hippocampal formation | 9.47 | ![]() |
8.99 | ![]() | |||
Slc27a3 | HY | Hypothalamus | 1.47 | ![]() |
0.98 | ![]() | |||
Slc27a3 | LSX | Lateral septal complex | 1.11 | ![]() |
1.23 | ![]() | |||
Slc27a3 | MB | Midbrain | 3.83 | ![]() |
3.79 | ![]() | |||
Slc27a3 | MY | Medulla | 3.16 | ![]() |
2.99 | ![]() | |||
Slc27a3 | OLF | Olfactory bulb | 7.78 | ![]() |
6.15 | ![]() | |||
Slc27a3 | P | Pons | 7.33 | ![]() |
7.13 | ![]() | |||
Slc27a3 | PAL | Pallidum | 0.83 | ![]() |
0.78 | ![]() | |||
Slc27a3 | RHP | Retrohippocampal region | 7.79 | ![]() |
7.23 | ![]() | |||
Slc27a3 | sAMY | Striatum-like amygdalar nuclei | 1.57 | ![]() |
1.45 | ![]() | |||
Slc27a3 | STR | Striatum | 1.08 | ![]() |
1.04 | ![]() | |||
Slc27a3 | STRd | Striatum dorsal region | 1.15 | ![]() |
1.2 | ![]() | |||
Slc27a3 | STRv | Striatum ventral region | 0.69 | ![]() |
0.4 | ![]() | |||
Slc27a3 | TH | Thalamus | 4.14 | ![]() |
3.32 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00095622 | 25 | 643 | 667 | DVFRPGDVFFNTGDLLVCDDQGFLR | Peptide Atlas |
S27A3_HUMAN_0 | 0 | 0 | 0 | ALVLAPEFLESLEPDLPALR | PRIDE |
S27A3_HUMAN_0 | 0 | 0 | 0 | LAVGSGLRPDTWER | PRIDE |
S27A3_HUMAN_0 | 0 | 0 | 0 | LQESLATTETFK | PRIDE |
S27A3_HUMAN_0 | 0 | 0 | 0 | MANEGFDPSTLSDPLYVLDQAVGAYLPLTTAR | PRIDE |
S27A3_HUMAN_0 | 0 | 0 | 0 | VTVFQYIGELCR | PRIDE |