Annotation Detail for CHD2
Basic Information Top
Gene Symbol: | CHD2 ( DKFZp547I1315,DKFZp686E01200,DKFZp781D1727,FLJ38614 ) |
---|---|
Gene Full Name: | chromodomain helicase DNA binding protein 2 |
Band: | 15q26.1 |
Quick Links | Entrez ID:1106; OMIM: 602119; Uniprot ID:CHD2_HUMAN; ENSEMBL ID: ENSG00000173575; HGNC ID: 1917 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.220864
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 8 / 70761 | 113 | |
blastocyst | 9 / 62319 | 144 | |
fetus | 99 / 564012 | 175 | |
neonate | 1 / 31097 | 32 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 370 / 1939121 | 190 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 2 / 12794 | 156 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 18 / 94178 | 191 | |
cervical tumor | 3 / 34366 | 87 | |
chondrosarcoma | 10 / 82823 | 120 | |
colorectal tumor | 19 / 114246 | 166 | |
esophageal tumor | 1 / 17290 | 57 | |
gastrointestinal tumor | 10 / 119369 | 83 | |
germ cell tumor | 17 / 263845 | 64 | |
glioma | 12 / 106883 | 112 | |
head and neck tumor | 33 / 136302 | 242 | |
kidney tumor | 5 / 68959 | 72 | |
leukemia | 22 / 95842 | 229 | |
liver tumor | 6 / 96359 | 62 | |
lung tumor | 18 / 103127 | 174 | |
lymphoma | 2 / 71755 | 27 | |
non-neoplasia | 12 / 97250 | 123 | |
normal | 448 / 3360307 | 133 | |
ovarian tumor | 17 / 76682 | 221 | |
pancreatic tumor | 4 / 104616 | 38 | |
primitive neuroectodermal tumor of the CNS | 8 / 125680 | 63 | |
prostate cancer | 17 / 102680 | 165 | |
retinoblastoma | 2 / 46356 | 43 | |
skin tumor | 3 / 124949 | 24 | |
soft tissue/muscle tissue tumor | 74 / 125191 | 591 | |
uterine tumor | 13 / 90257 | 144 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 2 / 33197 | 60 | |
ascites | 6 / 40015 | 149 | |
bladder | 2 / 29757 | 67 | |
blood | 21 / 123478 | 170 | |
bone | 15 / 71655 | 209 | |
bone marrow | 4 / 48801 | 81 | |
brain | 84 / 1100989 | 76 | |
cervix | 3 / 48171 | 62 | |
connective tissue | 71 / 149255 | 475 | |
ear | 4 / 16212 | 246 | |
embryonic tissue | 28 / 215722 | 129 | |
esophagus | 1 / 20209 | 49 | |
eye | 22 / 211054 | 104 | |
heart | 13 / 89626 | 145 | |
intestine | 29 / 234472 | 123 | |
kidney | 25 / 211777 | 118 | |
larynx | 7 / 24145 | 289 | |
liver | 53 / 207743 | 255 | |
lung | 82 / 336974 | 243 | |
lymph | 2 / 44270 | 45 | |
lymph node | 13 / 91610 | 141 | |
mammary gland | 26 / 153271 | 169 | |
mouth | 15 / 67052 | 223 | |
muscle | 5 / 107715 | 46 | |
nerve | 1 / 15768 | 63 | |
ovary | 23 / 102051 | 225 | |
pancreas | 25 / 214812 | 116 | |
parathyroid | 2 / 20539 | 97 | |
pharynx | 13 / 41328 | 314 | |
pituitary gland | 1 / 16585 | 60 | |
placenta | 17 / 280825 | 60 | |
prostate | 28 / 189345 | 147 | |
salivary gland | 1 / 20155 | 49 | |
skin | 13 / 210574 | 61 | |
spleen | 5 / 53952 | 92 | |
stomach | 5 / 96619 | 51 | |
testis | 14 / 330442 | 42 | |
thymus | 16 / 81131 | 197 | |
thyroid | 11 / 47473 | 231 | |
tonsil | 2 / 16999 | 117 | |
trachea | 2 / 52413 | 38 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 28 / 232878 | 120 | |
vascular | 5 / 51780 | 96 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: CUST_1156_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 7.4 ± 0.28 | |
Basal Forebrain | 7.4 ± 0.19 | |
Basal Part of Pons | 7.32 ± 0.15 | |
Cerebellar Cortex | 7.37 ± 0.19 | |
Cerebellar Nuclei | 7.03 ± 0.16 | |
Claustrum | 7.65 ± 0.33 | |
Epithalamus | 7.24 ± 0.25 | |
Frontal Lobe | 7.04 ± 0.32 | |
Globus Pallidus | 7.73 ± 0.2 | |
Hypothalamus | 6.94 ± 0.29 | |
Insula | 7.09 ± 0.24 | |
Limbic Lobe | 7.2 ± 0.36 | |
Mesencephalon | 7.19 ± 0.27 | |
Myelencephalon | 7.13 ± 0.33 | |
Occipital Lobe | 7.39 ± 0.32 | |
Parietal Lobe | 7.21 ± 0.36 | |
Pontine Tegmentum | 7.06 ± 0.36 | |
Striatum | 7 ± 0.36 | |
Subthalamus | 7.18 ± 0.13 | |
Temporal Lobe | 7.07 ± 0.33 | |
Thalamus | 7.12 ± 0.27 | |
White Matter | 7.98 ± 0.24 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00011528 | 33 | 1441 | 1473 | SQGPVHITAGSEPVPIGEDEDDDLDQETFSICK | Peptide Atlas |