Annotation Detail for FLYWCH2


Gene Symbol: | FLYWCH2 ( - ) |
---|---|
Gene Full Name: | FLYWCH family member 2 |
Band: | 16p13.3 |
Quick Links | Entrez ID:114984; OMIM: NA; Uniprot ID:FWCH2_HUMAN; ENSEMBL ID: ENSG00000162076; HGNC ID: 25178 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.534525
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 0 / 70761 | 0 | |
blastocyst | 1 / 62319 | 16 | ![]() |
fetus | 7 / 564012 | 12 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 32 / 1939121 | 16 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 3 / 94178 | 31 | ![]() |
cervical tumor | 1 / 34366 | 29 | ![]() |
chondrosarcoma | 3 / 82823 | 36 | ![]() |
colorectal tumor | 3 / 114246 | 26 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 2 / 263845 | 7 | ![]() |
glioma | 6 / 106883 | 56 | ![]() |
head and neck tumor | 4 / 136302 | 29 | ![]() |
kidney tumor | 2 / 68959 | 29 | ![]() |
leukemia | 1 / 95842 | 10 | ![]() |
liver tumor | 1 / 96359 | 10 | ![]() |
lung tumor | 1 / 103127 | 9 | ![]() |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 0 / 97250 | 0 | |
normal | 46 / 3360307 | 13 | ![]() |
ovarian tumor | 5 / 76682 | 65 | ![]() |
pancreatic tumor | 1 / 104616 | 9 | ![]() |
primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | ![]() |
prostate cancer | 2 / 102680 | 19 | ![]() |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 3 / 124949 | 24 | ![]() |
soft tissue/muscle tissue tumor | 5 / 125191 | 39 | ![]() |
uterine tumor | 1 / 90257 | 11 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 2 / 13106 | 152 | ![]() |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 2 / 123478 | 16 | ![]() |
bone | 3 / 71655 | 41 | ![]() |
bone marrow | 0 / 48801 | 0 | |
brain | 13 / 1100989 | 11 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 0 / 149255 | 0 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 3 / 215722 | 13 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 5 / 211054 | 23 | ![]() |
heart | 3 / 89626 | 33 | ![]() |
intestine | 3 / 234472 | 12 | ![]() |
kidney | 4 / 211777 | 18 | ![]() |
larynx | 2 / 24145 | 82 | ![]() |
liver | 1 / 207743 | 4 | ![]() |
lung | 12 / 336974 | 35 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 3 / 153271 | 19 | ![]() |
mouth | 0 / 67052 | 0 | |
muscle | 2 / 107715 | 18 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 7 / 102051 | 68 | ![]() |
pancreas | 3 / 214812 | 13 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 1 / 41328 | 24 | ![]() |
pituitary gland | 0 / 16585 | 0 | |
placenta | 6 / 280825 | 21 | ![]() |
prostate | 5 / 189345 | 26 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 4 / 210574 | 18 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 3 / 96619 | 31 | ![]() |
testis | 6 / 330442 | 18 | ![]() |
thymus | 0 / 81131 | 0 | |
thyroid | 1 / 47473 | 21 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 5 / 232878 | 21 | ![]() |
vascular | 0 / 51780 | 0 |
- Probe name: A_24_P417596
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.18 ± 0.9 | ![]() ![]() ![]() |
Basal Forebrain | 2.74 ± 0.52 | ![]() ![]() ![]() |
Basal Part of Pons | 2.97 ± 0.6 | ![]() ![]() ![]() |
Cerebellar Cortex | 3.31 ± 0.6 | ![]() ![]() ![]() |
Cerebellar Nuclei | 3.15 ± 0.43 | ![]() ![]() ![]() |
Claustrum | 3.3 ± 1.04 | ![]() ![]() ![]() |
Epithalamus | 2.56 ± 0.94 | ![]() ![]() ![]() |
Frontal Lobe | 2.98 ± 0.88 | ![]() ![]() ![]() |
Globus Pallidus | 2.88 ± 1.11 | ![]() ![]() ![]() |
Hypothalamus | 3.28 ± 0.87 | ![]() ![]() ![]() |
Insula | 2.99 ± 0.86 | ![]() ![]() ![]() |
Limbic Lobe | 3.06 ± 0.81 | ![]() ![]() ![]() |
Mesencephalon | 3.05 ± 0.85 | ![]() ![]() ![]() |
Myelencephalon | 2.96 ± 0.77 | ![]() ![]() ![]() |
Occipital Lobe | 3.02 ± 0.85 | ![]() ![]() ![]() |
Parietal Lobe | 3.04 ± 0.86 | ![]() ![]() ![]() |
Pontine Tegmentum | 3.08 ± 0.61 | ![]() ![]() ![]() |
Striatum | 2.8 ± 0.9 | ![]() ![]() ![]() |
Subthalamus | 3.28 ± 0.47 | ![]() ![]() ![]() |
Temporal Lobe | 2.83 ± 0.8 | ![]() ![]() ![]() |
Thalamus | 3.05 ± 0.74 | ![]() ![]() ![]() |
White Matter | 2.6 ± 0.95 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
2810417J12Rik | CB | Cerebellum | 24.21 | ![]() |
31.81 | ![]() | |||
2810417J12Rik | CTX | Cerebral cortex | 45.66 | ![]() |
33.68 | ![]() | |||
2810417J12Rik | HIP | Hippocampal region | 38.26 | ![]() |
39.25 | ![]() | |||
2810417J12Rik | HPF | Hippocampal formation | 42.17 | ![]() |
38.71 | ![]() | |||
2810417J12Rik | HY | Hypothalamus | 49.36 | ![]() |
38.47 | ![]() | |||
2810417J12Rik | LSX | Lateral septal complex | 16.56 | ![]() |
10.72 | ![]() | |||
2810417J12Rik | MB | Midbrain | 39.45 | ![]() |
33.42 | ![]() | |||
2810417J12Rik | MY | Medulla | 58.48 | ![]() |
65.85 | ![]() | |||
2810417J12Rik | OLF | Olfactory bulb | 55.14 | ![]() |
47.19 | ![]() | |||
2810417J12Rik | P | Pons | 55.01 | ![]() |
59.62 | ![]() | |||
2810417J12Rik | PAL | Pallidum | 38.38 | ![]() |
36.91 | ![]() | |||
2810417J12Rik | RHP | Retrohippocampal region | 52.92 | ![]() |
40.97 | ![]() | |||
2810417J12Rik | sAMY | Striatum-like amygdalar nuclei | 54.31 | ![]() |
40.01 | ![]() | |||
2810417J12Rik | STR | Striatum | 28.54 | ![]() |
20.69 | ![]() | |||
2810417J12Rik | STRd | Striatum dorsal region | 22.09 | ![]() |
15.46 | ![]() | |||
2810417J12Rik | STRv | Striatum ventral region | 43.18 | ![]() |
32.18 | ![]() | |||
2810417J12Rik | TH | Thalamus | 56.14 | ![]() |
46.82 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00011205 | 34 | 105 | 138 | QDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGK | Peptide Atlas |