Annotation Detail for CLCN3


Gene Symbol: | CLCN3 ( CLC3,ClC-3 ) |
---|---|
Gene Full Name: | chloride channel 3 |
Band: | 4q33 |
Quick Links | Entrez ID:1182; OMIM: 600580; Uniprot ID:CLCN3_HUMAN; ENSEMBL ID: ENSG00000109572; HGNC ID: 2021 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.481186
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 7 / 70761 | 98 | ![]() |
blastocyst | 3 / 62319 | 48 | ![]() |
fetus | 84 / 564012 | 148 | ![]() |
neonate | 1 / 31097 | 32 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 6 / 55556 | 107 | ![]() |
adult | 127 / 1939121 | 65 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 2 / 17475 | 114 | ![]() |
breast (mammary gland) tumor | 5 / 94178 | 53 | ![]() |
cervical tumor | 1 / 34366 | 29 | ![]() |
chondrosarcoma | 3 / 82823 | 36 | ![]() |
colorectal tumor | 13 / 114246 | 113 | ![]() |
esophageal tumor | 2 / 17290 | 115 | ![]() |
gastrointestinal tumor | 4 / 119369 | 33 | ![]() |
germ cell tumor | 20 / 263845 | 75 | ![]() |
glioma | 4 / 106883 | 37 | ![]() |
head and neck tumor | 31 / 136302 | 227 | ![]() |
kidney tumor | 3 / 68959 | 43 | ![]() |
leukemia | 8 / 95842 | 83 | ![]() |
liver tumor | 1 / 96359 | 10 | ![]() |
lung tumor | 5 / 103127 | 48 | ![]() |
lymphoma | 1 / 71755 | 13 | ![]() |
non-neoplasia | 2 / 97250 | 20 | ![]() |
normal | 316 / 3360307 | 94 | ![]() |
ovarian tumor | 1 / 76682 | 13 | ![]() |
pancreatic tumor | 13 / 104616 | 124 | ![]() |
primitive neuroectodermal tumor of the CNS | 7 / 125680 | 55 | ![]() |
prostate cancer | 6 / 102680 | 58 | ![]() |
retinoblastoma | 1 / 46356 | 21 | ![]() |
skin tumor | 7 / 124949 | 56 | ![]() |
soft tissue/muscle tissue tumor | 4 / 125191 | 31 | ![]() |
uterine tumor | 4 / 90257 | 44 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 2 / 33197 | 60 | ![]() |
ascites | 0 / 40015 | 0 | |
bladder | 1 / 29757 | 33 | ![]() |
blood | 7 / 123478 | 56 | ![]() |
bone | 1 / 71655 | 13 | ![]() |
bone marrow | 5 / 48801 | 102 | ![]() |
brain | 124 / 1100989 | 112 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 5 / 149255 | 33 | ![]() |
ear | 4 / 16212 | 246 | ![]() |
embryonic tissue | 14 / 215722 | 64 | ![]() |
esophagus | 2 / 20209 | 98 | ![]() |
eye | 21 / 211054 | 99 | ![]() |
heart | 5 / 89626 | 55 | ![]() |
intestine | 25 / 234472 | 106 | ![]() |
kidney | 11 / 211777 | 51 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 9 / 207743 | 43 | ![]() |
lung | 20 / 336974 | 59 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 8 / 91610 | 87 | ![]() |
mammary gland | 10 / 153271 | 65 | ![]() |
mouth | 28 / 67052 | 417 | ![]() |
muscle | 6 / 107715 | 55 | ![]() |
nerve | 4 / 15768 | 253 | ![]() |
ovary | 1 / 102051 | 9 | ![]() |
pancreas | 23 / 214812 | 107 | ![]() |
parathyroid | 2 / 20539 | 97 | ![]() |
pharynx | 1 / 41328 | 24 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 16 / 280825 | 56 | ![]() |
prostate | 18 / 189345 | 95 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 20 / 210574 | 94 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 5 / 96619 | 51 | ![]() |
testis | 24 / 330442 | 72 | ![]() |
thymus | 3 / 81131 | 36 | ![]() |
thyroid | 3 / 47473 | 63 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 7 / 52413 | 133 | ![]() |
umbilical cord | 1 / 13680 | 73 | ![]() |
uterus | 9 / 232878 | 38 | ![]() |
vascular | 3 / 51780 | 57 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201735_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 81.2 | ![]() |
Adipocyte | 20.35 | ![]() |
AdrenalCortex | 10.4 | ![]() |
Adrenalgland | 8.95 | ![]() |
Amygdala | 87.25 | ![]() |
Appendix | 17.6 | ![]() |
AtrioventricularNode | 6.4 | ![]() |
BDCA4+_DentriticCells | 45.5 | ![]() |
Bonemarrow | 8.8 | ![]() |
BronchialEpithelialCells | 19 | ![]() |
CD105+_Endothelial | 55.45 | ![]() |
CD14+_Monocytes | 22.5 | ![]() |
CD19+_BCells(neg._sel.) | 23.3 | ![]() |
CD33+_Myeloid | 29.9 | ![]() |
CD34+ | 22.4 | ![]() |
CD4+_Tcells | 37.75 | ![]() |
CD56+_NKCells | 29.25 | ![]() |
CD71+_EarlyErythroid | 359.25 | ![]() |
CD8+_Tcells | 23.05 | ![]() |
CardiacMyocytes | 18.95 | ![]() |
Caudatenucleus | 32.55 | ![]() |
Cerebellum | 15.45 | ![]() |
CerebellumPeduncles | 27.7 | ![]() |
CiliaryGanglion | 5.85 | ![]() |
CingulateCortex | 38.05 | ![]() |
Colorectaladenocarcinoma | 19.25 | ![]() |
DorsalRootGanglion | 9.1 | ![]() |
FetalThyroid | 7 | ![]() |
Fetalbrain | 55.1 | ![]() |
Fetalliver | 27.05 | ![]() |
Fetallung | 14.05 | ![]() |
GlobusPallidus | 15.3 | ![]() |
Heart | 10.75 | ![]() |
Hypothalamus | 73.9 | ![]() |
Kidney | 8.1 | ![]() |
Leukemia_chronicMyelogenousK-562 | 18.95 | ![]() |
Leukemia_promyelocytic-HL-60 | 14.75 | ![]() |
Leukemialymphoblastic(MOLT-4) | 13.8 | ![]() |
Liver | 10.8 | ![]() |
Lung | 9 | ![]() |
Lymphnode | 10.9 | ![]() |
Lymphoma_burkitts(Daudi) | 21.05 | ![]() |
Lymphoma_burkitts(Raji) | 21.2 | ![]() |
MedullaOblongata | 28.15 | ![]() |
OccipitalLobe | 91.75 | ![]() |
OlfactoryBulb | 27.75 | ![]() |
Ovary | 7.35 | ![]() |
Pancreas | 23.4 | ![]() |
PancreaticIslet | 41.25 | ![]() |
ParietalLobe | 54.45 | ![]() |
Pituitary | 45.35 | ![]() |
Placenta | 18.75 | ![]() |
Pons | 17.7 | ![]() |
PrefrontalCortex | 87.8 | ![]() |
Prostate | 26.65 | ![]() |
Salivarygland | 33.9 | ![]() |
SkeletalMuscle | 11.35 | ![]() |
Skin | 5.45 | ![]() |
SmoothMuscle | 23.55 | ![]() |
Spinalcord | 59 | ![]() |
SubthalamicNucleus | 14.65 | ![]() |
SuperiorCervicalGanglion | 11.1 | ![]() |
TemporalLobe | 6.6 | ![]() |
Testis | 9 | ![]() |
TestisGermCell | 52.95 | ![]() |
TestisIntersitial | 10.6 | ![]() |
TestisLeydigCell | 11.5 | ![]() |
TestisSeminiferousTubule | 10.7 | ![]() |
Thalamus | 64.55 | ![]() |
Thymus | 6.25 | ![]() |
Thyroid | 26.15 | ![]() |
Tongue | 8 | ![]() |
Tonsil | 12.3 | ![]() |
Trachea | 17.5 | ![]() |
TrigeminalGanglion | 8.5 | ![]() |
Uterus | 12.35 | ![]() |
UterusCorpus | 9.25 | ![]() |
WholeBlood | 22.4 | ![]() |
Wholebrain | 50.35 | ![]() |
colon | 70.7 | ![]() |
pineal_day | 467.18 | ![]() |
pineal_night | 431.54 | ![]() |
retina | 57.675 | ![]() |
small_intestine | 25.85 | ![]() |
- Probe name: A_24_P402847
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 8.57 ± 0.31 | ![]() ![]() ![]() |
Basal Forebrain | 8.66 ± 0.15 | ![]() ![]() ![]() |
Basal Part of Pons | 8.63 ± 0.11 | ![]() ![]() ![]() |
Cerebellar Cortex | 8.46 ± 0.24 | ![]() ![]() ![]() |
Cerebellar Nuclei | 8.97 ± 0.22 | ![]() ![]() ![]() |
Claustrum | 8.57 ± 0.32 | ![]() ![]() ![]() |
Epithalamus | 8.78 ± 0.24 | ![]() ![]() ![]() |
Frontal Lobe | 8.7 ± 0.29 | ![]() ![]() ![]() |
Globus Pallidus | 9.26 ± 0.2 | ![]() ![]() ![]() |
Hypothalamus | 8.8 ± 0.21 | ![]() ![]() ![]() |
Insula | 8.61 ± 0.22 | ![]() ![]() ![]() |
Limbic Lobe | 8.54 ± 0.41 | ![]() ![]() ![]() |
Mesencephalon | 8.72 ± 0.35 | ![]() ![]() ![]() |
Myelencephalon | 8.65 ± 0.31 | ![]() ![]() ![]() |
Occipital Lobe | 8.49 ± 0.31 | ![]() ![]() ![]() |
Parietal Lobe | 8.66 ± 0.3 | ![]() ![]() ![]() |
Pontine Tegmentum | 8.73 ± 0.28 | ![]() ![]() ![]() |
Striatum | 8.68 ± 0.19 | ![]() ![]() ![]() |
Subthalamus | 8.92 ± 0.51 | ![]() ![]() ![]() |
Temporal Lobe | 8.63 ± 0.27 | ![]() ![]() ![]() |
Thalamus | 8.74 ± 0.25 | ![]() ![]() ![]() |
White Matter | 9.85 ± 0.15 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Clcn3 | CB | Cerebellum | 71.1 | ![]() |
100 | ![]() | |||
Clcn3 | CTX | Cerebral cortex | 100 | ![]() |
100 | ![]() | |||
Clcn3 | HIP | Hippocampal region | 100 | ![]() |
100 | ![]() | |||
Clcn3 | HPF | Hippocampal formation | 100 | ![]() |
100 | ![]() | |||
Clcn3 | HY | Hypothalamus | 100 | ![]() |
100 | ![]() | |||
Clcn3 | LSX | Lateral septal complex | 97.09 | ![]() |
89.05 | ![]() | |||
Clcn3 | MB | Midbrain | 100 | ![]() |
100 | ![]() | |||
Clcn3 | MY | Medulla | 93.85 | ![]() |
100 | ![]() | |||
Clcn3 | OLF | Olfactory bulb | 100 | ![]() |
100 | ![]() | |||
Clcn3 | P | Pons | 83.8 | ![]() |
100 | ![]() | |||
Clcn3 | PAL | Pallidum | 97.75 | ![]() |
100 | ![]() | |||
Clcn3 | RHP | Retrohippocampal region | 100 | ![]() |
100 | ![]() | |||
Clcn3 | sAMY | Striatum-like amygdalar nuclei | 100 | ![]() |
100 | ![]() | |||
Clcn3 | STR | Striatum | 100 | ![]() |
100 | ![]() | |||
Clcn3 | STRd | Striatum dorsal region | 100 | ![]() |
100 | ![]() | |||
Clcn3 | STRv | Striatum ventral region | 100 | ![]() |
100 | ![]() | |||
Clcn3 | TH | Thalamus | 100 | ![]() |
100 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
CLCN3_HUMAN_726 | 9 | 726 | 734 | QCLVTHNGR | PRIDE |
PAp00042332 | 37 | 662 | 698 | RNDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSK | Peptide Atlas |