Annotation Detail for CLCN3
Basic Information Top
| Gene Symbol: | CLCN3 ( CLC3,ClC-3 ) |
|---|---|
| Gene Full Name: | chloride channel 3 |
| Band: | 4q33 |
| Quick Links | Entrez ID:1182; OMIM: 600580; Uniprot ID:CLCN3_HUMAN; ENSEMBL ID: ENSG00000109572; HGNC ID: 2021 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.481186
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 7 / 70761 | 98 | |
| blastocyst | 3 / 62319 | 48 | |
| fetus | 84 / 564012 | 148 | |
| neonate | 1 / 31097 | 32 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 6 / 55556 | 107 | |
| adult | 127 / 1939121 | 65 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 2 / 17475 | 114 | |
| breast (mammary gland) tumor | 5 / 94178 | 53 | |
| cervical tumor | 1 / 34366 | 29 | |
| chondrosarcoma | 3 / 82823 | 36 | |
| colorectal tumor | 13 / 114246 | 113 | |
| esophageal tumor | 2 / 17290 | 115 | |
| gastrointestinal tumor | 4 / 119369 | 33 | |
| germ cell tumor | 20 / 263845 | 75 | |
| glioma | 4 / 106883 | 37 | |
| head and neck tumor | 31 / 136302 | 227 | |
| kidney tumor | 3 / 68959 | 43 | |
| leukemia | 8 / 95842 | 83 | |
| liver tumor | 1 / 96359 | 10 | |
| lung tumor | 5 / 103127 | 48 | |
| lymphoma | 1 / 71755 | 13 | |
| non-neoplasia | 2 / 97250 | 20 | |
| normal | 316 / 3360307 | 94 | |
| ovarian tumor | 1 / 76682 | 13 | |
| pancreatic tumor | 13 / 104616 | 124 | |
| primitive neuroectodermal tumor of the CNS | 7 / 125680 | 55 | |
| prostate cancer | 6 / 102680 | 58 | |
| retinoblastoma | 1 / 46356 | 21 | |
| skin tumor | 7 / 124949 | 56 | |
| soft tissue/muscle tissue tumor | 4 / 125191 | 31 | |
| uterine tumor | 4 / 90257 | 44 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 2 / 33197 | 60 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 1 / 29757 | 33 | |
| blood | 7 / 123478 | 56 | |
| bone | 1 / 71655 | 13 | |
| bone marrow | 5 / 48801 | 102 | |
| brain | 124 / 1100989 | 112 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 5 / 149255 | 33 | |
| ear | 4 / 16212 | 246 | |
| embryonic tissue | 14 / 215722 | 64 | |
| esophagus | 2 / 20209 | 98 | |
| eye | 21 / 211054 | 99 | |
| heart | 5 / 89626 | 55 | |
| intestine | 25 / 234472 | 106 | |
| kidney | 11 / 211777 | 51 | |
| larynx | 0 / 24145 | 0 | |
| liver | 9 / 207743 | 43 | |
| lung | 20 / 336974 | 59 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 8 / 91610 | 87 | |
| mammary gland | 10 / 153271 | 65 | |
| mouth | 28 / 67052 | 417 | |
| muscle | 6 / 107715 | 55 | |
| nerve | 4 / 15768 | 253 | |
| ovary | 1 / 102051 | 9 | |
| pancreas | 23 / 214812 | 107 | |
| parathyroid | 2 / 20539 | 97 | |
| pharynx | 1 / 41328 | 24 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 16 / 280825 | 56 | |
| prostate | 18 / 189345 | 95 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 20 / 210574 | 94 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 5 / 96619 | 51 | |
| testis | 24 / 330442 | 72 | |
| thymus | 3 / 81131 | 36 | |
| thyroid | 3 / 47473 | 63 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 7 / 52413 | 133 | |
| umbilical cord | 1 / 13680 | 73 | |
| uterus | 9 / 232878 | 38 | |
| vascular | 3 / 51780 | 57 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201735_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 81.2 | |
| Adipocyte | 20.35 | |
| AdrenalCortex | 10.4 | |
| Adrenalgland | 8.95 | |
| Amygdala | 87.25 | |
| Appendix | 17.6 | |
| AtrioventricularNode | 6.4 | |
| BDCA4+_DentriticCells | 45.5 | |
| Bonemarrow | 8.8 | |
| BronchialEpithelialCells | 19 | |
| CD105+_Endothelial | 55.45 | |
| CD14+_Monocytes | 22.5 | |
| CD19+_BCells(neg._sel.) | 23.3 | |
| CD33+_Myeloid | 29.9 | |
| CD34+ | 22.4 | |
| CD4+_Tcells | 37.75 | |
| CD56+_NKCells | 29.25 | |
| CD71+_EarlyErythroid | 359.25 | |
| CD8+_Tcells | 23.05 | |
| CardiacMyocytes | 18.95 | |
| Caudatenucleus | 32.55 | |
| Cerebellum | 15.45 | |
| CerebellumPeduncles | 27.7 | |
| CiliaryGanglion | 5.85 | |
| CingulateCortex | 38.05 | |
| Colorectaladenocarcinoma | 19.25 | |
| DorsalRootGanglion | 9.1 | |
| FetalThyroid | 7 | |
| Fetalbrain | 55.1 | |
| Fetalliver | 27.05 | |
| Fetallung | 14.05 | |
| GlobusPallidus | 15.3 | |
| Heart | 10.75 | |
| Hypothalamus | 73.9 | |
| Kidney | 8.1 | |
| Leukemia_chronicMyelogenousK-562 | 18.95 | |
| Leukemia_promyelocytic-HL-60 | 14.75 | |
| Leukemialymphoblastic(MOLT-4) | 13.8 | |
| Liver | 10.8 | |
| Lung | 9 | |
| Lymphnode | 10.9 | |
| Lymphoma_burkitts(Daudi) | 21.05 | |
| Lymphoma_burkitts(Raji) | 21.2 | |
| MedullaOblongata | 28.15 | |
| OccipitalLobe | 91.75 | |
| OlfactoryBulb | 27.75 | |
| Ovary | 7.35 | |
| Pancreas | 23.4 | |
| PancreaticIslet | 41.25 | |
| ParietalLobe | 54.45 | |
| Pituitary | 45.35 | |
| Placenta | 18.75 | |
| Pons | 17.7 | |
| PrefrontalCortex | 87.8 | |
| Prostate | 26.65 | |
| Salivarygland | 33.9 | |
| SkeletalMuscle | 11.35 | |
| Skin | 5.45 | |
| SmoothMuscle | 23.55 | |
| Spinalcord | 59 | |
| SubthalamicNucleus | 14.65 | |
| SuperiorCervicalGanglion | 11.1 | |
| TemporalLobe | 6.6 | |
| Testis | 9 | |
| TestisGermCell | 52.95 | |
| TestisIntersitial | 10.6 | |
| TestisLeydigCell | 11.5 | |
| TestisSeminiferousTubule | 10.7 | |
| Thalamus | 64.55 | |
| Thymus | 6.25 | |
| Thyroid | 26.15 | |
| Tongue | 8 | |
| Tonsil | 12.3 | |
| Trachea | 17.5 | |
| TrigeminalGanglion | 8.5 | |
| Uterus | 12.35 | |
| UterusCorpus | 9.25 | |
| WholeBlood | 22.4 | |
| Wholebrain | 50.35 | |
| colon | 70.7 | |
| pineal_day | 467.18 | |
| pineal_night | 431.54 | |
| retina | 57.675 | |
| small_intestine | 25.85 |
- Probe name: A_24_P402847
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 8.57 ± 0.31 | |
| Basal Forebrain | 8.66 ± 0.15 | |
| Basal Part of Pons | 8.63 ± 0.11 | |
| Cerebellar Cortex | 8.46 ± 0.24 | |
| Cerebellar Nuclei | 8.97 ± 0.22 | |
| Claustrum | 8.57 ± 0.32 | |
| Epithalamus | 8.78 ± 0.24 | |
| Frontal Lobe | 8.7 ± 0.29 | |
| Globus Pallidus | 9.26 ± 0.2 | |
| Hypothalamus | 8.8 ± 0.21 | |
| Insula | 8.61 ± 0.22 | |
| Limbic Lobe | 8.54 ± 0.41 | |
| Mesencephalon | 8.72 ± 0.35 | |
| Myelencephalon | 8.65 ± 0.31 | |
| Occipital Lobe | 8.49 ± 0.31 | |
| Parietal Lobe | 8.66 ± 0.3 | |
| Pontine Tegmentum | 8.73 ± 0.28 | |
| Striatum | 8.68 ± 0.19 | |
| Subthalamus | 8.92 ± 0.51 | |
| Temporal Lobe | 8.63 ± 0.27 | |
| Thalamus | 8.74 ± 0.25 | |
| White Matter | 9.85 ± 0.15 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Clcn3 | CB | Cerebellum | 71.1 | |
| 100 | ||||
| Clcn3 | CTX | Cerebral cortex | 100 | |
| 100 | ||||
| Clcn3 | HIP | Hippocampal region | 100 | |
| 100 | ||||
| Clcn3 | HPF | Hippocampal formation | 100 | |
| 100 | ||||
| Clcn3 | HY | Hypothalamus | 100 | |
| 100 | ||||
| Clcn3 | LSX | Lateral septal complex | 97.09 | |
| 89.05 | ||||
| Clcn3 | MB | Midbrain | 100 | |
| 100 | ||||
| Clcn3 | MY | Medulla | 93.85 | |
| 100 | ||||
| Clcn3 | OLF | Olfactory bulb | 100 | |
| 100 | ||||
| Clcn3 | P | Pons | 83.8 | |
| 100 | ||||
| Clcn3 | PAL | Pallidum | 97.75 | |
| 100 | ||||
| Clcn3 | RHP | Retrohippocampal region | 100 | |
| 100 | ||||
| Clcn3 | sAMY | Striatum-like amygdalar nuclei | 100 | |
| 100 | ||||
| Clcn3 | STR | Striatum | 100 | |
| 100 | ||||
| Clcn3 | STRd | Striatum dorsal region | 100 | |
| 100 | ||||
| Clcn3 | STRv | Striatum ventral region | 100 | |
| 100 | ||||
| Clcn3 | TH | Thalamus | 100 | |
| 100 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| CLCN3_HUMAN_726 | 9 | 726 | 734 | QCLVTHNGR | PRIDE |
| PAp00042332 | 37 | 662 | 698 | RNDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSK | Peptide Atlas |



