Annotation Detail for CNN3
Basic Information Top
Gene Symbol: | CNN3 ( - ) |
---|---|
Gene Full Name: | calponin 3, acidic |
Band: | 1p21.3 |
Quick Links | Entrez ID:1266; OMIM: 602374; Uniprot ID:CNN3_HUMAN; ENSEMBL ID: ENSG00000117519; HGNC ID: 2157 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.483454
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 15 / 70761 | 211 | |
blastocyst | 10 / 62319 | 160 | |
fetus | 39 / 564012 | 69 | |
neonate | 12 / 31097 | 385 | |
infant | 6 / 23620 | 254 | |
juvenile | 3 / 55556 | 53 | |
adult | 191 / 1939121 | 98 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 5 / 12794 | 390 | |
bladder carcinoma | 4 / 17475 | 228 | |
breast (mammary gland) tumor | 6 / 94178 | 63 | |
cervical tumor | 3 / 34366 | 87 | |
chondrosarcoma | 8 / 82823 | 96 | |
colorectal tumor | 5 / 114246 | 43 | |
esophageal tumor | 10 / 17290 | 578 | |
gastrointestinal tumor | 8 / 119369 | 67 | |
germ cell tumor | 28 / 263845 | 106 | |
glioma | 16 / 106883 | 149 | |
head and neck tumor | 13 / 136302 | 95 | |
kidney tumor | 8 / 68959 | 116 | |
leukemia | 2 / 95842 | 20 | |
liver tumor | 10 / 96359 | 103 | |
lung tumor | 6 / 103127 | 58 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 18 / 97250 | 185 | |
normal | 405 / 3360307 | 120 | |
ovarian tumor | 3 / 76682 | 39 | |
pancreatic tumor | 13 / 104616 | 124 | |
primitive neuroectodermal tumor of the CNS | 12 / 125680 | 95 | |
prostate cancer | 3 / 102680 | 29 | |
retinoblastoma | 1 / 46356 | 21 | |
skin tumor | 31 / 124949 | 248 | |
soft tissue/muscle tissue tumor | 12 / 125191 | 95 | |
uterine tumor | 10 / 90257 | 110 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 3 / 13106 | 228 | |
adrenal gland | 16 / 33197 | 481 | |
ascites | 2 / 40015 | 49 | |
bladder | 13 / 29757 | 436 | |
blood | 1 / 123478 | 8 | |
bone | 10 / 71655 | 139 | |
bone marrow | 2 / 48801 | 40 | |
brain | 145 / 1100989 | 131 | |
cervix | 6 / 48171 | 124 | |
connective tissue | 9 / 149255 | 60 | |
ear | 6 / 16212 | 370 | |
embryonic tissue | 48 / 215722 | 222 | |
esophagus | 11 / 20209 | 544 | |
eye | 28 / 211054 | 132 | |
heart | 10 / 89626 | 111 | |
intestine | 15 / 234472 | 63 | |
kidney | 30 / 211777 | 141 | |
larynx | 6 / 24145 | 248 | |
liver | 15 / 207743 | 72 | |
lung | 44 / 336974 | 130 | |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 11 / 153271 | 71 | |
mouth | 2 / 67052 | 29 | |
muscle | 8 / 107715 | 74 | |
nerve | 6 / 15768 | 380 | |
ovary | 4 / 102051 | 39 | |
pancreas | 14 / 214812 | 65 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 1 / 41328 | 24 | |
pituitary gland | 1 / 16585 | 60 | |
placenta | 39 / 280825 | 138 | |
prostate | 11 / 189345 | 58 | |
salivary gland | 2 / 20155 | 99 | |
skin | 37 / 210574 | 175 | |
spleen | 0 / 53952 | 0 | |
stomach | 7 / 96619 | 72 | |
testis | 25 / 330442 | 75 | |
thymus | 4 / 81131 | 49 | |
thyroid | 2 / 47473 | 42 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 10 / 13680 | 730 | |
uterus | 40 / 232878 | 171 | |
vascular | 8 / 51780 | 154 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201445_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 215.05 | |
Adipocyte | 252.85 | |
AdrenalCortex | 57.8 | |
Adrenalgland | 109.5 | |
Amygdala | 160.95 | |
Appendix | 41.75 | |
AtrioventricularNode | 18 | |
BDCA4+_DentriticCells | 4.75 | |
Bonemarrow | 4.65 | |
BronchialEpithelialCells | 123.9 | |
CD105+_Endothelial | 9.6 | |
CD14+_Monocytes | 4.7 | |
CD19+_BCells(neg._sel.) | 5.5 | |
CD33+_Myeloid | 6.45 | |
CD34+ | 6 | |
CD4+_Tcells | 4.95 | |
CD56+_NKCells | 5.9 | |
CD71+_EarlyErythroid | 5.7 | |
CD8+_Tcells | 4.35 | |
CardiacMyocytes | 37.35 | |
Caudatenucleus | 57.35 | |
Cerebellum | 19.55 | |
CerebellumPeduncles | 31.2 | |
CiliaryGanglion | 22.15 | |
CingulateCortex | 19 | |
Colorectaladenocarcinoma | 4.55 | |
DorsalRootGanglion | 32.25 | |
FetalThyroid | 14.4 | |
Fetalbrain | 126.85 | |
Fetalliver | 17.6 | |
Fetallung | 243.2 | |
GlobusPallidus | 9.7 | |
Heart | 6.15 | |
Hypothalamus | 78.35 | |
Kidney | 97.1 | |
Leukemia_chronicMyelogenousK-562 | 5.2 | |
Leukemia_promyelocytic-HL-60 | 4.55 | |
Leukemialymphoblastic(MOLT-4) | 4.7 | |
Liver | 13.5 | |
Lung | 176.75 | |
Lymphnode | 32.35 | |
Lymphoma_burkitts(Daudi) | 6.85 | |
Lymphoma_burkitts(Raji) | 6.25 | |
MedullaOblongata | 36.8 | |
OccipitalLobe | 60.15 | |
OlfactoryBulb | 209.75 | |
Ovary | 79.95 | |
Pancreas | 26.8 | |
PancreaticIslet | 64.55 | |
ParietalLobe | 17.2 | |
Pituitary | 27.05 | |
Placenta | 255.8 | |
Pons | 28.6 | |
PrefrontalCortex | 59.25 | |
Prostate | 207.1 | |
Salivarygland | 10.85 | |
SkeletalMuscle | 14.25 | |
Skin | 4.35 | |
SmoothMuscle | 44.25 | |
Spinalcord | 125.95 | |
SubthalamicNucleus | 11.8 | |
SuperiorCervicalGanglion | 14.4 | |
TemporalLobe | 34.25 | |
Testis | 20.65 | |
TestisGermCell | 14.75 | |
TestisIntersitial | 20.3 | |
TestisLeydigCell | 26.45 | |
TestisSeminiferousTubule | 21.05 | |
Thalamus | 40.35 | |
Thymus | 28.05 | |
Thyroid | 158.05 | |
Tongue | 15.2 | |
Tonsil | 6.1 | |
Trachea | 84.75 | |
TrigeminalGanglion | 20.35 | |
Uterus | 335.4 | |
UterusCorpus | 44.05 | |
WholeBlood | 5.15 | |
Wholebrain | 83 | |
colon | 217.95 | |
pineal_day | 79.14 | |
pineal_night | 54.84 | |
retina | 403.425 | |
small_intestine | 307.9 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_23_P138168
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 9.77 ± 0.31 | |
Basal Forebrain | 9.76 ± 0.22 | |
Basal Part of Pons | 8.88 ± 0.25 | |
Cerebellar Cortex | 8.95 ± 0.18 | |
Cerebellar Nuclei | 9.09 ± 0.31 | |
Claustrum | 9.35 ± 0.29 | |
Epithalamus | 10.2 ± 0.31 | |
Frontal Lobe | 9.27 ± 0.41 | |
Globus Pallidus | 10.53 ± 0.39 | |
Hypothalamus | 9.58 ± 0.39 | |
Insula | 9.25 ± 0.36 | |
Limbic Lobe | 9.29 ± 0.53 | |
Mesencephalon | 9.6 ± 0.39 | |
Myelencephalon | 9.47 ± 0.49 | |
Occipital Lobe | 9.24 ± 0.41 | |
Parietal Lobe | 9.29 ± 0.48 | |
Pontine Tegmentum | 9.41 ± 0.36 | |
Striatum | 9.99 ± 0.46 | |
Subthalamus | 8.98 ± 0.17 | |
Temporal Lobe | 9.31 ± 0.34 | |
Thalamus | 9.48 ± 0.29 | |
White Matter | 9.76 ± 0.3 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Cnn3 | CB | Cerebellum | 28.69 | |
81.3 | ||||
Cnn3 | CTX | Cerebral cortex | 17.42 | |
14.44 | ||||
Cnn3 | HIP | Hippocampal region | 30.07 | |
42.83 | ||||
Cnn3 | HPF | Hippocampal formation | 29.51 | |
35.03 | ||||
Cnn3 | HY | Hypothalamus | 8.47 | |
7.56 | ||||
Cnn3 | LSX | Lateral septal complex | 27 | |
29.21 | ||||
Cnn3 | MB | Midbrain | 16.27 | |
20.39 | ||||
Cnn3 | MY | Medulla | 39.89 | |
51.48 | ||||
Cnn3 | OLF | Olfactory bulb | 60.59 | |
70.05 | ||||
Cnn3 | P | Pons | 29.47 | |
35.41 | ||||
Cnn3 | PAL | Pallidum | 10.03 | |
10.95 | ||||
Cnn3 | RHP | Retrohippocampal region | 28.9 | |
23.98 | ||||
Cnn3 | sAMY | Striatum-like amygdalar nuclei | 7.7 | |
8.73 | ||||
Cnn3 | STR | Striatum | 16.87 | |
17.48 | ||||
Cnn3 | STRd | Striatum dorsal region | 17.92 | |
18.2 | ||||
Cnn3 | STRv | Striatum ventral region | 8.49 | |
8.07 | ||||
Cnn3 | TH | Thalamus | 36.34 | |
39.54 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
CNN3_HUMAN_158 | 14 | 158 | 171 | AGQSVIGLQMGTNK | PRIDE |
CNN3_HUMAN_159 | 14 | 159 | 172 | AGQSVIGLQMGTNK | PRIDE |
CNN3_HUMAN_17 | 16 | 17 | 32 | NKIASKYDHQAEEDLR | PRIDE |
CNN3_HUMAN_19 | 14 | 19 | 32 | IASKYDHQAEEDLR | PRIDE |
CNN3_HUMAN_192 | 20 | 192 | 211 | MQTDKPFDQTTISLQMGTNK | PRIDE |
CNN3_HUMAN_193 | 20 | 193 | 212 | MQTDKPFDQTTISLQMGTNK | PRIDE |
CNN3_HUMAN_2 | 32 | 2 | 33 | THFNKGPSYGLSAEVKNKIASKYDHQAEEDLR | PRIDE |
CNN3_HUMAN_212 | 14 | 212 | 225 | GASQAGMLAPGTRR | PRIDE |
CNN3_HUMAN_213 | 13 | 213 | 225 | GASQAGMLAPGTR | PRIDE |
CNN3_HUMAN_233 | 19 | 233 | 251 | LTLQPVDNSTISLQMGTNK | PRIDE |
CNN3_HUMAN_256 | 9 | 256 | 264 | GMSVYGLGR | PRIDE |
CNN3_HUMAN_257 | 9 | 257 | 265 | GMSVYGLGR | PRIDE |
CNN3_HUMAN_53 | 11 | 53 | 63 | DGIILCELINK | PRIDE |
CNN3_HUMAN_53 | 18 | 53 | 70 | DGIILCELINKLQPGSVK | PRIDE |
CNN3_HUMAN_6 | 11 | 6 | 16 | GPSYGLSAEVK | PRIDE |
CNN3_HUMAN_72 | 19 | 72 | 90 | VNESSLNWPQLENIGNFIK | PRIDE |
PAp00000864 | 13 | 173 | 185 | CASQAGMTAYGTR | Peptide Atlas |