Annotation Detail for COMT
Basic Information Top
Gene Symbol: | COMT ( - ) |
---|---|
Gene Full Name: | catechol-O-methyltransferase |
Band: | 22q11.21 |
Quick Links | Entrez ID:1312; OMIM: 116790; Uniprot ID:COMT_HUMAN; ENSEMBL ID: ENSG00000093010; HGNC ID: 2228 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.704514
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 55 / 564012 | 97 | |
neonate | 1 / 31097 | 32 | |
infant | 1 / 23620 | 42 | |
juvenile | 1 / 55556 | 17 | |
adult | 263 / 1939121 | 135 | |
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 3 / 564012 | 5 | |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 3 / 1939121 | 1 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 1 / 17475 | 57 | |
breast (mammary gland) tumor | 14 / 94178 | 148 | |
cervical tumor | 3 / 34366 | 87 | |
chondrosarcoma | 16 / 82823 | 193 | |
colorectal tumor | 23 / 114246 | 201 | |
esophageal tumor | 1 / 17290 | 57 | |
gastrointestinal tumor | 18 / 119369 | 150 | |
germ cell tumor | 21 / 263845 | 79 | |
glioma | 27 / 106883 | 252 | |
head and neck tumor | 10 / 136302 | 73 | |
kidney tumor | 3 / 68959 | 43 | |
leukemia | 8 / 95842 | 83 | |
liver tumor | 6 / 96359 | 62 | |
lung tumor | 9 / 103127 | 87 | |
lymphoma | 14 / 71755 | 195 | |
non-neoplasia | 8 / 97250 | 82 | |
normal | 378 / 3360307 | 112 | |
ovarian tumor | 13 / 76682 | 169 | |
pancreatic tumor | 20 / 104616 | 191 | |
primitive neuroectodermal tumor of the CNS | 13 / 125680 | 103 | |
prostate cancer | 17 / 102680 | 165 | |
retinoblastoma | 5 / 46356 | 107 | |
skin tumor | 162 / 124949 | 1296 | |
soft tissue/muscle tissue tumor | 23 / 125191 | 183 | |
uterine tumor | 12 / 90257 | 132 | |
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 0 / 114246 | 0 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 0 / 263845 | 0 | |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 0 / 97250 | 0 | |
normal | 5 / 3360307 | 1 | |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 2 / 13106 | 152 | |
adrenal gland | 1 / 33197 | 30 | |
ascites | 1 / 40015 | 24 | |
bladder | 4 / 29757 | 134 | |
blood | 6 / 123478 | 48 | |
bone | 14 / 71655 | 195 | |
bone marrow | 3 / 48801 | 61 | |
brain | 119 / 1100989 | 108 | |
cervix | 3 / 48171 | 62 | |
connective tissue | 11 / 149255 | 73 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 1 / 215722 | 4 | |
esophagus | 2 / 20209 | 98 | |
eye | 44 / 211054 | 208 | |
heart | 9 / 89626 | 100 | |
intestine | 39 / 234472 | 166 | |
kidney | 25 / 211777 | 118 | |
larynx | 0 / 24145 | 0 | |
liver | 11 / 207743 | 52 | |
lung | 44 / 336974 | 130 | |
lymph | 6 / 44270 | 135 | |
lymph node | 15 / 91610 | 163 | |
mammary gland | 16 / 153271 | 104 | |
mouth | 5 / 67052 | 74 | |
muscle | 23 / 107715 | 213 | |
nerve | 2 / 15768 | 126 | |
ovary | 16 / 102051 | 156 | |
pancreas | 42 / 214812 | 195 | |
parathyroid | 4 / 20539 | 194 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 1 / 16585 | 60 | |
placenta | 71 / 280825 | 252 | |
prostate | 35 / 189345 | 184 | |
salivary gland | 2 / 20155 | 99 | |
skin | 184 / 210574 | 873 | |
spleen | 0 / 53952 | 0 | |
stomach | 12 / 96619 | 124 | |
testis | 8 / 330442 | 24 | |
thymus | 1 / 81131 | 12 | |
thyroid | 3 / 47473 | 63 | |
tonsil | 5 / 16999 | 294 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 16 / 232878 | 68 | |
vascular | 4 / 51780 | 77 | |
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 0 / 123478 | 0 | |
bone | 0 / 71655 | 0 | |
bone marrow | 0 / 48801 | 0 | |
brain | 2 / 1100989 | 1 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 0 / 149255 | 0 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 0 / 20209 | 0 | |
eye | 0 / 211054 | 0 | |
heart | 1 / 89626 | 11 | |
intestine | 0 / 234472 | 0 | |
kidney | 0 / 211777 | 0 | |
larynx | 0 / 24145 | 0 | |
liver | 0 / 207743 | 0 | |
lung | 0 / 336974 | 0 | |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 1 / 153271 | 6 | |
mouth | 0 / 67052 | 0 | |
muscle | 0 / 107715 | 0 | |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 1 / 16585 | 60 | |
placenta | 0 / 280825 | 0 | |
prostate | 0 / 189345 | 0 | |
salivary gland | 0 / 20155 | 0 | |
skin | 0 / 210574 | 0 | |
spleen | 0 / 53952 | 0 | |
stomach | 0 / 96619 | 0 | |
testis | 0 / 330442 | 0 | |
thymus | 0 / 81131 | 0 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 0 / 232878 | 0 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 208818_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 822.45 | |
Adipocyte | 404.25 | |
AdrenalCortex | 329.45 | |
Adrenalgland | 1044.85 | |
Amygdala | 495.4 | |
Appendix | 81.5 | |
AtrioventricularNode | 157.85 | |
BDCA4+_DentriticCells | 1005.7 | |
Bonemarrow | 274.35 | |
BronchialEpithelialCells | 618.1 | |
CD105+_Endothelial | 298.25 | |
CD14+_Monocytes | 1101.05 | |
CD19+_BCells(neg._sel.) | 369.8 | |
CD33+_Myeloid | 1046.6 | |
CD34+ | 1037.6 | |
CD4+_Tcells | 239.5 | |
CD56+_NKCells | 432.65 | |
CD71+_EarlyErythroid | 273.9 | |
CD8+_Tcells | 219.8 | |
CardiacMyocytes | 526.8 | |
Caudatenucleus | 458.9 | |
Cerebellum | 401.8 | |
CerebellumPeduncles | 410.5 | |
CiliaryGanglion | 159 | |
CingulateCortex | 281.7 | |
Colorectaladenocarcinoma | 163.6 | |
DorsalRootGanglion | 214 | |
FetalThyroid | 323.6 | |
Fetalbrain | 332.7 | |
Fetalliver | 210.6 | |
Fetallung | 472.55 | |
GlobusPallidus | 162.5 | |
Heart | 476.2 | |
Hypothalamus | 585.8 | |
Kidney | 404.45 | |
Leukemia_chronicMyelogenousK-562 | 2624.1 | |
Leukemia_promyelocytic-HL-60 | 368.1 | |
Leukemialymphoblastic(MOLT-4) | 356.95 | |
Liver | 5648.8 | |
Lung | 2156.4 | |
Lymphnode | 273.2 | |
Lymphoma_burkitts(Daudi) | 409.4 | |
Lymphoma_burkitts(Raji) | 1068.85 | |
MedullaOblongata | 250.1 | |
OccipitalLobe | 322.65 | |
OlfactoryBulb | 883.2 | |
Ovary | 119.75 | |
Pancreas | 274.55 | |
PancreaticIslet | 265.95 | |
ParietalLobe | 278.65 | |
Pituitary | 275.15 | |
Placenta | 1426.1 | |
Pons | 130.1 | |
PrefrontalCortex | 514.5 | |
Prostate | 1297.2 | |
Salivarygland | 244.2 | |
SkeletalMuscle | 132.2 | |
Skin | 199.85 | |
SmoothMuscle | 675.7 | |
Spinalcord | 874.8 | |
SubthalamicNucleus | 248 | |
SuperiorCervicalGanglion | 154.9 | |
TemporalLobe | 220.2 | |
Testis | 360.25 | |
TestisGermCell | 379 | |
TestisIntersitial | 115 | |
TestisLeydigCell | 137.7 | |
TestisSeminiferousTubule | 128.75 | |
Thalamus | 472.65 | |
Thymus | 335.3 | |
Thyroid | 661.45 | |
Tongue | 338 | |
Tonsil | 251.2 | |
Trachea | 289.6 | |
TrigeminalGanglion | 90.3 | |
Uterus | 417.7 | |
UterusCorpus | 171.15 | |
WholeBlood | 487.3 | |
Wholebrain | 632.5 | |
colon | 308 | |
pineal_day | 1016.48 | |
pineal_night | 1080.2 | |
retina | 790.725 | |
small_intestine | 482.3 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: CUST_1031_PI417557136
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.11 ± 0.48 | |
Basal Forebrain | 5.44 ± 0.36 | |
Basal Part of Pons | 4.97 ± 0.38 | |
Cerebellar Cortex | 4.91 ± 0.18 | |
Cerebellar Nuclei | 5.53 ± 0.36 | |
Claustrum | 5.06 ± 0.43 | |
Epithalamus | 5.82 ± 0.3 | |
Frontal Lobe | 5.28 ± 0.41 | |
Globus Pallidus | 6.45 ± 0.31 | |
Hypothalamus | 5.05 ± 0.53 | |
Insula | 5.08 ± 0.44 | |
Limbic Lobe | 5.23 ± 0.49 | |
Mesencephalon | 5.44 ± 0.46 | |
Myelencephalon | 5.38 ± 0.47 | |
Occipital Lobe | 5.25 ± 0.45 | |
Parietal Lobe | 5.17 ± 0.43 | |
Pontine Tegmentum | 5.26 ± 0.4 | |
Striatum | 5.64 ± 0.34 | |
Subthalamus | 5.1 ± 0.4 | |
Temporal Lobe | 5.08 ± 0.42 | |
Thalamus | 5.38 ± 0.51 | |
White Matter | 6.87 ± 0.3 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Comt | CB | Cerebellum | 2.37 | |
4.39 | ||||
Comt | CTX | Cerebral cortex | 47.5 | |
47.13 | ||||
Comt | HIP | Hippocampal region | 38.79 | |
89.52 | ||||
Comt | HPF | Hippocampal formation | 33.76 | |
66.17 | ||||
Comt | HY | Hypothalamus | 31.59 | |
32 | ||||
Comt | LSX | Lateral septal complex | 8.89 | |
8.08 | ||||
Comt | MB | Midbrain | 3.25 | |
5.52 | ||||
Comt | MY | Medulla | 1.3 | |
2.85 | ||||
Comt | OLF | Olfactory bulb | 31.44 | |
41.5 | ||||
Comt | P | Pons | 7.49 | |
14.62 | ||||
Comt | PAL | Pallidum | 39.94 | |
46.65 | ||||
Comt | RHP | Retrohippocampal region | 22.64 | |
25.3 | ||||
Comt | sAMY | Striatum-like amygdalar nuclei | 57.16 | |
52.63 | ||||
Comt | STR | Striatum | 66.65 | |
62.16 | ||||
Comt | STRd | Striatum dorsal region | 80.9 | |
74.42 | ||||
Comt | STRv | Striatum ventral region | 58.94 | |
56.82 | ||||
Comt | TH | Thalamus | 60.21 | |
73.84 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
COMT_HUMAN_0 | 0 | 0 | 0 | AIYKGPGSEAGP | PRIDE |
COMT_HUMAN_135 | 16 | 135 | 150 | LITIEINPDCAAITQR | PRIDE |
COMT_HUMAN_178 | 16 | 178 | 193 | KYDVDTLDMVFLDHWK | PRIDE |
COMT_HUMAN_194 | 17 | 194 | 210 | DRYLPDTLLLEECGLLR | PRIDE |
COMT_HUMAN_196 | 15 | 196 | 210 | YLPDTLLLEECGLLR | PRIDE |
COMT_HUMAN_211 | 23 | 211 | 233 | KGTVLLADNVICPGAPDFLAHVR | PRIDE |
COMT_HUMAN_212 | 22 | 212 | 233 | GTVLLADNVICPGAPDFLAHVR | PRIDE |
COMT_HUMAN_259 | 12 | 259 | 270 | AIYKGPGSEAGP | PRIDE |
COMT_HUMAN_58 | 28 | 58 | 85 | ILNHVLQHAEPGNAQSVLEAIDTYCEQK | PRIDE |
COMT_HUMAN_58 | 38 | 58 | 95 | ILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKK | PRIDE |
COMT_HUMAN_98 | 27 | 98 | 124 | IVDAVIQEHQPSVLLELGAYCGYSAVR | PRIDE |
PAp00001789 | 17 | 195 | 211 | DRYLPDTLLLEECGLLR | Peptide Atlas |