Annotation Detail for CP
Basic Information Top
Gene Symbol: | CP ( CP-2 ) |
---|---|
Gene Full Name: | ceruloplasmin (ferroxidase) |
Band: | 3q24-q25.1 |
Quick Links | Entrez ID:1356; OMIM: 117700; Uniprot ID:CERU_HUMAN; ENSEMBL ID: ENSG00000047457; HGNC ID: 2295 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.558314
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 9 / 564012 | 15 | |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 3 / 55556 | 53 | |
adult | 184 / 1939121 | 94 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 1 / 17475 | 57 | |
breast (mammary gland) tumor | 20 / 94178 | 212 | |
cervical tumor | 1 / 34366 | 29 | |
chondrosarcoma | 2 / 82823 | 24 | |
colorectal tumor | 0 / 114246 | 0 | |
esophageal tumor | 1 / 17290 | 57 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 8 / 263845 | 30 | |
glioma | 6 / 106883 | 56 | |
head and neck tumor | 60 / 136302 | 440 | |
kidney tumor | 1 / 68959 | 14 | |
leukemia | 1 / 95842 | 10 | |
liver tumor | 20 / 96359 | 207 | |
lung tumor | 1 / 103127 | 9 | |
lymphoma | 1 / 71755 | 13 | |
non-neoplasia | 15 / 97250 | 154 | |
normal | 286 / 3360307 | 85 | |
ovarian tumor | 23 / 76682 | 299 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 3 / 125191 | 23 | |
uterine tumor | 30 / 90257 | 332 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 1 / 29757 | 33 | |
blood | 1 / 123478 | 8 | |
bone | 1 / 71655 | 13 | |
bone marrow | 1 / 48801 | 20 | |
brain | 45 / 1100989 | 40 | |
cervix | 5 / 48171 | 103 | |
connective tissue | 16 / 149255 | 107 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 3 / 215722 | 13 | |
esophagus | 1 / 20209 | 49 | |
eye | 52 / 211054 | 246 | |
heart | 0 / 89626 | 0 | |
intestine | 2 / 234472 | 8 | |
kidney | 22 / 211777 | 103 | |
larynx | 0 / 24145 | 0 | |
liver | 156 / 207743 | 750 | |
lung | 30 / 336974 | 89 | |
lymph | 0 / 44270 | 0 | |
lymph node | 1 / 91610 | 10 | |
mammary gland | 23 / 153271 | 150 | |
mouth | 61 / 67052 | 909 | |
muscle | 3 / 107715 | 27 | |
nerve | 0 / 15768 | 0 | |
ovary | 25 / 102051 | 244 | |
pancreas | 2 / 214812 | 9 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 6 / 280825 | 21 | |
prostate | 6 / 189345 | 31 | |
salivary gland | 0 / 20155 | 0 | |
skin | 0 / 210574 | 0 | |
spleen | 3 / 53952 | 55 | |
stomach | 2 / 96619 | 20 | |
testis | 10 / 330442 | 30 | |
thymus | 2 / 81131 | 24 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 87 / 52413 | 1659 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 36 / 232878 | 154 | |
vascular | 2 / 51780 | 38 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 204846_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 8.65 | |
Adipocyte | 8.1 | |
AdrenalCortex | 9.5 | |
Adrenalgland | 7.65 | |
Amygdala | 8.05 | |
Appendix | 9.55 | |
AtrioventricularNode | 11.1 | |
BDCA4+_DentriticCells | 8.1 | |
Bonemarrow | 9.15 | |
BronchialEpithelialCells | 7.85 | |
CD105+_Endothelial | 38.6 | |
CD14+_Monocytes | 8.5 | |
CD19+_BCells(neg._sel.) | 8.4 | |
CD33+_Myeloid | 10.2 | |
CD34+ | 9.35 | |
CD4+_Tcells | 8.75 | |
CD56+_NKCells | 9.25 | |
CD71+_EarlyErythroid | 7.65 | |
CD8+_Tcells | 6.95 | |
CardiacMyocytes | 11.55 | |
Caudatenucleus | 7.45 | |
Cerebellum | 6.65 | |
CerebellumPeduncles | 9.75 | |
CiliaryGanglion | 12.25 | |
CingulateCortex | 8.45 | |
Colorectaladenocarcinoma | 7.95 | |
DorsalRootGanglion | 8.9 | |
FetalThyroid | 8.3 | |
Fetalbrain | 7.9 | |
Fetalliver | 79.9 | |
Fetallung | 18.2 | |
GlobusPallidus | 7.35 | |
Heart | 11.15 | |
Hypothalamus | 11.4 | |
Kidney | 6.85 | |
Leukemia_chronicMyelogenousK-562 | 7.35 | |
Leukemia_promyelocytic-HL-60 | 7.2 | |
Leukemialymphoblastic(MOLT-4) | 6.15 | |
Liver | 14.55 | |
Lung | 8.6 | |
Lymphnode | 9.55 | |
Lymphoma_burkitts(Daudi) | 10.35 | |
Lymphoma_burkitts(Raji) | 11.7 | |
MedullaOblongata | 7.45 | |
OccipitalLobe | 7.15 | |
OlfactoryBulb | 7.1 | |
Ovary | 5.65 | |
Pancreas | 7.1 | |
PancreaticIslet | 22.55 | |
ParietalLobe | 10.8 | |
Pituitary | 28.75 | |
Placenta | 7.9 | |
Pons | 8.4 | |
PrefrontalCortex | 9.95 | |
Prostate | 9.35 | |
Salivarygland | 9.45 | |
SkeletalMuscle | 10.75 | |
Skin | 7.75 | |
SmoothMuscle | 9 | |
Spinalcord | 8.85 | |
SubthalamicNucleus | 8.55 | |
SuperiorCervicalGanglion | 18.3 | |
TemporalLobe | 7.85 | |
Testis | 6.85 | |
TestisGermCell | 6.4 | |
TestisIntersitial | 7.3 | |
TestisLeydigCell | 8.3 | |
TestisSeminiferousTubule | 7.05 | |
Thalamus | 8.55 | |
Thymus | 5.9 | |
Thyroid | 9.4 | |
Tongue | 10.85 | |
Tonsil | 10.15 | |
Trachea | 32.15 | |
TrigeminalGanglion | 13.1 | |
Uterus | 6.75 | |
UterusCorpus | 7.75 | |
WholeBlood | 8.55 | |
Wholebrain | 6.25 | |
colon | 8.05 | |
pineal_day | 14.04 | |
pineal_night | 24.04 | |
retina | 29.75 | |
small_intestine | 7.65 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_23_P40817
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 6.15 ± 0.56 | |
Basal Forebrain | 6.1 ± 0.23 | |
Basal Part of Pons | 6.31 ± 0.26 | |
Cerebellar Cortex | 6.29 ± 0.3 | |
Cerebellar Nuclei | 6.71 ± 0.28 | |
Claustrum | 6.06 ± 0.71 | |
Epithalamus | 6.72 ± 0.17 | |
Frontal Lobe | 6.31 ± 0.43 | |
Globus Pallidus | 6.64 ± 0.3 | |
Hypothalamus | 6.55 ± 0.42 | |
Insula | 6.31 ± 0.37 | |
Limbic Lobe | 6.19 ± 0.5 | |
Mesencephalon | 6.37 ± 0.49 | |
Myelencephalon | 6.28 ± 0.41 | |
Occipital Lobe | 6.3 ± 0.36 | |
Parietal Lobe | 6.28 ± 0.31 | |
Pontine Tegmentum | 6.35 ± 0.48 | |
Striatum | 5.81 ± 0.39 | |
Subthalamus | 6.86 ± 0.16 | |
Temporal Lobe | 6.43 ± 0.44 | |
Thalamus | 6.27 ± 0.3 | |
White Matter | 6.68 ± 0.19 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00024005 | 33 | 145 | 177 | ADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTR | Peptide Atlas |