Annotation Detail for CPA1


Gene Symbol: | CPA1 ( CPA ) |
---|---|
Gene Full Name: | carboxypeptidase A1 (pancreatic) |
Band: | 7q32.2 |
Quick Links | Entrez ID:1357; OMIM: 114850; Uniprot ID:CBPA1_HUMAN; ENSEMBL ID: ENSG00000091704; HGNC ID: 2296 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.2879
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 12 / 564012 | 21 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 170 / 1939121 | 87 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 0 / 114246 | 0 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 0 / 263845 | 0 | |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 0 / 97250 | 0 | |
normal | 212 / 3360307 | 63 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 72 / 104616 | 688 | ![]() |
primitive neuroectodermal tumor of the CNS | 3 / 125680 | 23 | ![]() |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 5 / 125191 | 39 | ![]() |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 1 / 33197 | 30 | ![]() |
ascites | 0 / 40015 | 0 | |
bladder | 14 / 29757 | 470 | ![]() |
blood | 0 / 123478 | 0 | |
bone | 0 / 71655 | 0 | |
bone marrow | 0 / 48801 | 0 | |
brain | 0 / 1100989 | 0 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 5 / 149255 | 33 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 0 / 20209 | 0 | |
eye | 0 / 211054 | 0 | |
heart | 0 / 89626 | 0 | |
intestine | 0 / 234472 | 0 | |
kidney | 0 / 211777 | 0 | |
larynx | 0 / 24145 | 0 | |
liver | 11 / 207743 | 52 | ![]() |
lung | 1 / 336974 | 2 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 0 / 153271 | 0 | |
mouth | 0 / 67052 | 0 | |
muscle | 0 / 107715 | 0 | |
nerve | 0 / 15768 | 0 | |
ovary | 2 / 102051 | 19 | ![]() |
pancreas | 888 / 214812 | 4133 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 4 / 280825 | 14 | ![]() |
prostate | 1 / 189345 | 5 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 0 / 210574 | 0 | |
spleen | 0 / 53952 | 0 | |
stomach | 0 / 96619 | 0 | |
testis | 0 / 330442 | 0 | |
thymus | 2 / 81131 | 24 | ![]() |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 0 / 232878 | 0 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 205615_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 5.7 | ![]() |
Adipocyte | 4.7 | ![]() |
AdrenalCortex | 5.3 | ![]() |
Adrenalgland | 4.1 | ![]() |
Amygdala | 4.85 | ![]() |
Appendix | 4.95 | ![]() |
AtrioventricularNode | 3.9 | ![]() |
BDCA4+_DentriticCells | 4.85 | ![]() |
Bonemarrow | 5.85 | ![]() |
BronchialEpithelialCells | 4.65 | ![]() |
CD105+_Endothelial | 4.95 | ![]() |
CD14+_Monocytes | 5.1 | ![]() |
CD19+_BCells(neg._sel.) | 4.95 | ![]() |
CD33+_Myeloid | 6.05 | ![]() |
CD34+ | 5.85 | ![]() |
CD4+_Tcells | 5.05 | ![]() |
CD56+_NKCells | 5.45 | ![]() |
CD71+_EarlyErythroid | 4.45 | ![]() |
CD8+_Tcells | 4.45 | ![]() |
CardiacMyocytes | 6.85 | ![]() |
Caudatenucleus | 4.2 | ![]() |
Cerebellum | 3.85 | ![]() |
CerebellumPeduncles | 5.5 | ![]() |
CiliaryGanglion | 3.6 | ![]() |
CingulateCortex | 4.9 | ![]() |
Colorectaladenocarcinoma | 4.7 | ![]() |
DorsalRootGanglion | 3.85 | ![]() |
FetalThyroid | 4.6 | ![]() |
Fetalbrain | 4.6 | ![]() |
Fetalliver | 10.8 | ![]() |
Fetallung | 3.8 | ![]() |
GlobusPallidus | 3.65 | ![]() |
Heart | 6.65 | ![]() |
Hypothalamus | 5.1 | ![]() |
Kidney | 4 | ![]() |
Leukemia_chronicMyelogenousK-562 | 4.25 | ![]() |
Leukemia_promyelocytic-HL-60 | 4.15 | ![]() |
Leukemialymphoblastic(MOLT-4) | 3.75 | ![]() |
Liver | 6.7 | ![]() |
Lung | 5.15 | ![]() |
Lymphnode | 3.95 | ![]() |
Lymphoma_burkitts(Daudi) | 6.1 | ![]() |
Lymphoma_burkitts(Raji) | 6.9 | ![]() |
MedullaOblongata | 4.3 | ![]() |
OccipitalLobe | 4.2 | ![]() |
OlfactoryBulb | 3.7 | ![]() |
Ovary | 3.2 | ![]() |
Pancreas | 10730.55 | ![]() |
PancreaticIslet | 5121.5 | ![]() |
ParietalLobe | 5.15 | ![]() |
Pituitary | 5.5 | ![]() |
Placenta | 4.75 | ![]() |
Pons | 4.6 | ![]() |
PrefrontalCortex | 5.8 | ![]() |
Prostate | 5.5 | ![]() |
Salivarygland | 3.85 | ![]() |
SkeletalMuscle | 5.8 | ![]() |
Skin | 3.85 | ![]() |
SmoothMuscle | 5.3 | ![]() |
Spinalcord | 5.05 | ![]() |
SubthalamicNucleus | 4.45 | ![]() |
SuperiorCervicalGanglion | 5.7 | ![]() |
TemporalLobe | 4.35 | ![]() |
Testis | 4 | ![]() |
TestisGermCell | 3.85 | ![]() |
TestisIntersitial | 4.1 | ![]() |
TestisLeydigCell | 4.75 | ![]() |
TestisSeminiferousTubule | 4 | ![]() |
Thalamus | 4.85 | ![]() |
Thymus | 3.65 | ![]() |
Thyroid | 5.8 | ![]() |
Tongue | 5.3 | ![]() |
Tonsil | 4.6 | ![]() |
Trachea | 3.95 | ![]() |
TrigeminalGanglion | 7.35 | ![]() |
Uterus | 3.85 | ![]() |
UterusCorpus | 4.35 | ![]() |
WholeBlood | 5.1 | ![]() |
Wholebrain | 3.85 | ![]() |
colon | 4.7 | ![]() |
pineal_day | 5.82 | ![]() |
pineal_night | 5.72 | ![]() |
retina | 5.675 | ![]() |
small_intestine | 4.55 | ![]() |
- Probe name: CUST_9731_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 1.83 ± 0.87 | ![]() ![]() ![]() |
Basal Forebrain | 1.72 ± 0.86 | ![]() ![]() ![]() |
Basal Part of Pons | 1.28 ± 0.41 | ![]() ![]() ![]() |
Cerebellar Cortex | 1.43 ± 0.82 | ![]() ![]() ![]() |
Cerebellar Nuclei | 2 ± 0.94 | ![]() ![]() ![]() |
Claustrum | 2.68 ± 1.04 | ![]() ![]() ![]() |
Epithalamus | 1.55 ± 0.96 | ![]() ![]() ![]() |
Frontal Lobe | 1.48 ± 0.75 | ![]() ![]() ![]() |
Globus Pallidus | 2.34 ± 0.53 | ![]() ![]() ![]() |
Hypothalamus | 1.51 ± 0.76 | ![]() ![]() ![]() |
Insula | 1.46 ± 0.51 | ![]() ![]() ![]() |
Limbic Lobe | 1.65 ± 0.77 | ![]() ![]() ![]() |
Mesencephalon | 1.83 ± 0.8 | ![]() ![]() ![]() |
Myelencephalon | 1.68 ± 0.78 | ![]() ![]() ![]() |
Occipital Lobe | 1.63 ± 0.65 | ![]() ![]() ![]() |
Parietal Lobe | 1.67 ± 0.99 | ![]() ![]() ![]() |
Pontine Tegmentum | 1.68 ± 0.79 | ![]() ![]() ![]() |
Striatum | 1.96 ± 0.76 | ![]() ![]() ![]() |
Subthalamus | 1.78 ± 0.68 | ![]() ![]() ![]() |
Temporal Lobe | 1.49 ± 0.66 | ![]() ![]() ![]() |
Thalamus | 1.73 ± 0.92 | ![]() ![]() ![]() |
White Matter | 2.26 ± 0.41 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Cpa1 | CB | Cerebellum | 0.67 | ![]() |
1.05 | ![]() | |||
Cpa1 | CTX | Cerebral cortex | 0.33 | ![]() |
0.33 | ![]() | |||
Cpa1 | HIP | Hippocampal region | 0.57 | ![]() |
0.51 | ![]() | |||
Cpa1 | HPF | Hippocampal formation | 0.48 | ![]() |
0.44 | ![]() | |||
Cpa1 | HY | Hypothalamus | 1.79 | ![]() |
3.56 | ![]() | |||
Cpa1 | LSX | Lateral septal complex | 0 | ![]() |
0 | ![]() | |||
Cpa1 | MB | Midbrain | 0.47 | ![]() |
1.08 | ![]() | |||
Cpa1 | MY | Medulla | 0.1 | ![]() |
0.41 | ![]() | |||
Cpa1 | OLF | Olfactory bulb | 0.36 | ![]() |
0.65 | ![]() | |||
Cpa1 | P | Pons | 2.89 | ![]() |
5.1 | ![]() | |||
Cpa1 | PAL | Pallidum | 0.59 | ![]() |
1.89 | ![]() | |||
Cpa1 | RHP | Retrohippocampal region | 0.08 | ![]() |
0.07 | ![]() | |||
Cpa1 | sAMY | Striatum-like amygdalar nuclei | 0.85 | ![]() |
1.81 | ![]() | |||
Cpa1 | STR | Striatum | 0.24 | ![]() |
0.5 | ![]() | |||
Cpa1 | STRd | Striatum dorsal region | 0.07 | ![]() |
0.08 | ![]() | |||
Cpa1 | STRv | Striatum ventral region | 0.49 | ![]() |
1.14 | ![]() | |||
Cpa1 | TH | Thalamus | 0.02 | ![]() |
0.02 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00424139 | 32 | 77 | 108 | IFLESHGISYETMIEDVQSLLDEEQEQMFAFR | Peptide Atlas |