Annotation Detail for QSOX2


Gene Symbol: | QSOX2 ( DKFZp762A2013,QSCN6L1,SOXN ) |
---|---|
Gene Full Name: | quiescin Q6 sulfhydryl oxidase 2 |
Band: | 9q34.3 |
Quick Links | Entrez ID:169714; OMIM: 612860; Uniprot ID:QSOX2_HUMAN; ENSEMBL ID: ENSG00000165661; HGNC ID: 30249 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.657864
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 5 / 70761 | 70 | ![]() |
blastocyst | 2 / 62319 | 32 | ![]() |
fetus | 9 / 564012 | 15 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 1 / 23620 | 42 | ![]() |
juvenile | 0 / 55556 | 0 | |
adult | 21 / 1939121 | 10 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | ![]() |
cervical tumor | 1 / 34366 | 29 | ![]() |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 1 / 114246 | 8 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 4 / 119369 | 33 | ![]() |
germ cell tumor | 6 / 263845 | 22 | ![]() |
glioma | 2 / 106883 | 18 | ![]() |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 7 / 95842 | 73 | ![]() |
liver tumor | 1 / 96359 | 10 | ![]() |
lung tumor | 2 / 103127 | 19 | ![]() |
lymphoma | 2 / 71755 | 27 | ![]() |
non-neoplasia | 0 / 97250 | 0 | |
normal | 52 / 3360307 | 15 | ![]() |
ovarian tumor | 1 / 76682 | 13 | ![]() |
pancreatic tumor | 2 / 104616 | 19 | ![]() |
primitive neuroectodermal tumor of the CNS | 4 / 125680 | 31 | ![]() |
prostate cancer | 1 / 102680 | 9 | ![]() |
retinoblastoma | 4 / 46356 | 86 | ![]() |
skin tumor | 5 / 124949 | 40 | ![]() |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 1 / 90257 | 11 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 2 / 40015 | 49 | ![]() |
bladder | 0 / 29757 | 0 | |
blood | 2 / 123478 | 16 | ![]() |
bone | 1 / 71655 | 13 | ![]() |
bone marrow | 1 / 48801 | 20 | ![]() |
brain | 7 / 1100989 | 6 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 0 / 149255 | 0 | |
ear | 2 / 16212 | 123 | ![]() |
embryonic tissue | 9 / 215722 | 41 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 11 / 211054 | 52 | ![]() |
heart | 0 / 89626 | 0 | |
intestine | 10 / 234472 | 42 | ![]() |
kidney | 0 / 211777 | 0 | |
larynx | 0 / 24145 | 0 | |
liver | 1 / 207743 | 4 | ![]() |
lung | 5 / 336974 | 14 | ![]() |
lymph | 1 / 44270 | 22 | ![]() |
lymph node | 7 / 91610 | 76 | ![]() |
mammary gland | 1 / 153271 | 6 | ![]() |
mouth | 0 / 67052 | 0 | |
muscle | 0 / 107715 | 0 | |
nerve | 1 / 15768 | 63 | ![]() |
ovary | 3 / 102051 | 29 | ![]() |
pancreas | 6 / 214812 | 27 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 2 / 280825 | 7 | ![]() |
prostate | 1 / 189345 | 5 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 5 / 210574 | 23 | ![]() |
spleen | 4 / 53952 | 74 | ![]() |
stomach | 0 / 96619 | 0 | |
testis | 6 / 330442 | 18 | ![]() |
thymus | 1 / 81131 | 12 | ![]() |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 2 / 232878 | 8 | ![]() |
vascular | 0 / 51780 | 0 |
- Probe name: A_24_P263682
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 4.1 ± 0.69 | ![]() ![]() ![]() |
Basal Forebrain | 3.95 ± 0.8 | ![]() ![]() ![]() |
Basal Part of Pons | 3.87 ± 0.44 | ![]() ![]() ![]() |
Cerebellar Cortex | 4.48 ± 0.31 | ![]() ![]() ![]() |
Cerebellar Nuclei | 3.89 ± 0.6 | ![]() ![]() ![]() |
Claustrum | 3.96 ± 0.63 | ![]() ![]() ![]() |
Epithalamus | 4.23 ± 0.63 | ![]() ![]() ![]() |
Frontal Lobe | 3.66 ± 0.64 | ![]() ![]() ![]() |
Globus Pallidus | 3.57 ± 0.92 | ![]() ![]() ![]() |
Hypothalamus | 3.79 ± 0.5 | ![]() ![]() ![]() |
Insula | 3.85 ± 0.56 | ![]() ![]() ![]() |
Limbic Lobe | 4.04 ± 0.62 | ![]() ![]() ![]() |
Mesencephalon | 3.86 ± 0.58 | ![]() ![]() ![]() |
Myelencephalon | 3.86 ± 0.6 | ![]() ![]() ![]() |
Occipital Lobe | 4.23 ± 0.63 | ![]() ![]() ![]() |
Parietal Lobe | 3.92 ± 0.59 | ![]() ![]() ![]() |
Pontine Tegmentum | 3.99 ± 0.73 | ![]() ![]() ![]() |
Striatum | 4.35 ± 0.64 | ![]() ![]() ![]() |
Subthalamus | 4.01 ± 0.28 | ![]() ![]() ![]() |
Temporal Lobe | 3.89 ± 0.54 | ![]() ![]() ![]() |
Thalamus | 3.82 ± 0.58 | ![]() ![]() ![]() |
White Matter | 3.99 ± 1.13 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Qscn6l1 | CB | Cerebellum | 20.15 | ![]() |
21.64 | ![]() | |||
Qscn6l1 | CTX | Cerebral cortex | 52.52 | ![]() |
41.04 | ![]() | |||
Qscn6l1 | HIP | Hippocampal region | 40.45 | ![]() |
68.91 | ![]() | |||
Qscn6l1 | HPF | Hippocampal formation | 42.77 | ![]() |
55.12 | ![]() | |||
Qscn6l1 | HY | Hypothalamus | 24.7 | ![]() |
19.82 | ![]() | |||
Qscn6l1 | LSX | Lateral septal complex | 66.66 | ![]() |
51.62 | ![]() | |||
Qscn6l1 | MB | Midbrain | 21.47 | ![]() |
18.46 | ![]() | |||
Qscn6l1 | MY | Medulla | 22.81 | ![]() |
22.86 | ![]() | |||
Qscn6l1 | OLF | Olfactory bulb | 66.99 | ![]() |
63.6 | ![]() | |||
Qscn6l1 | P | Pons | 18.43 | ![]() |
18.02 | ![]() | |||
Qscn6l1 | PAL | Pallidum | 24.21 | ![]() |
22.15 | ![]() | |||
Qscn6l1 | RHP | Retrohippocampal region | 46.04 | ![]() |
39.86 | ![]() | |||
Qscn6l1 | sAMY | Striatum-like amygdalar nuclei | 36.19 | ![]() |
26.63 | ![]() | |||
Qscn6l1 | STR | Striatum | 50.39 | ![]() |
37.46 | ![]() | |||
Qscn6l1 | STRd | Striatum dorsal region | 48.63 | ![]() |
35.82 | ![]() | |||
Qscn6l1 | STRv | Striatum ventral region | 59.67 | ![]() |
44.68 | ![]() | |||
Qscn6l1 | TH | Thalamus | 17.4 | ![]() |
15.99 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00041450 | 33 | 435 | 467 | LFHTLTVEASTHPDALVGTGFEDDPQAVLQTMR | Peptide Atlas |