Annotation Detail for STOM


Gene Symbol: | STOM ( BND7,EPB7,EPB72 ) |
---|---|
Gene Full Name: | stomatin |
Band: | 9q33.2 |
Quick Links | Entrez ID:2040; OMIM: 133090; Uniprot ID:STOM_HUMAN; ENSEMBL ID: ENSG00000148175; HGNC ID: 3383 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.253903
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 2 / 70761 | 28 | ![]() |
blastocyst | 2 / 62319 | 32 | ![]() |
fetus | 85 / 564012 | 150 | ![]() |
neonate | 15 / 31097 | 482 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 2 / 55556 | 35 | ![]() |
adult | 366 / 1939121 | 188 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 4 / 17475 | 228 | ![]() |
breast (mammary gland) tumor | 9 / 94178 | 95 | ![]() |
cervical tumor | 5 / 34366 | 145 | ![]() |
chondrosarcoma | 14 / 82823 | 169 | ![]() |
colorectal tumor | 6 / 114246 | 52 | ![]() |
esophageal tumor | 3 / 17290 | 173 | ![]() |
gastrointestinal tumor | 17 / 119369 | 142 | ![]() |
germ cell tumor | 38 / 263845 | 144 | ![]() |
glioma | 13 / 106883 | 121 | ![]() |
head and neck tumor | 18 / 136302 | 132 | ![]() |
kidney tumor | 8 / 68959 | 116 | ![]() |
leukemia | 25 / 95842 | 260 | ![]() |
liver tumor | 4 / 96359 | 41 | ![]() |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 1 / 71755 | 13 | ![]() |
non-neoplasia | 15 / 97250 | 154 | ![]() |
normal | 578 / 3360307 | 172 | ![]() |
ovarian tumor | 1 / 76682 | 13 | ![]() |
pancreatic tumor | 3 / 104616 | 28 | ![]() |
primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | ![]() |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 2 / 46356 | 43 | ![]() |
skin tumor | 4 / 124949 | 32 | ![]() |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 10 / 90257 | 110 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 5 / 13106 | 381 | ![]() |
adrenal gland | 3 / 33197 | 90 | ![]() |
ascites | 3 / 40015 | 74 | ![]() |
bladder | 4 / 29757 | 134 | ![]() |
blood | 41 / 123478 | 332 | ![]() |
bone | 5 / 71655 | 69 | ![]() |
bone marrow | 3 / 48801 | 61 | ![]() |
brain | 148 / 1100989 | 134 | ![]() |
cervix | 5 / 48171 | 103 | ![]() |
connective tissue | 21 / 149255 | 140 | ![]() |
ear | 4 / 16212 | 246 | ![]() |
embryonic tissue | 10 / 215722 | 46 | ![]() |
esophagus | 3 / 20209 | 148 | ![]() |
eye | 20 / 211054 | 94 | ![]() |
heart | 21 / 89626 | 234 | ![]() |
intestine | 15 / 234472 | 63 | ![]() |
kidney | 28 / 211777 | 132 | ![]() |
larynx | 1 / 24145 | 41 | ![]() |
liver | 33 / 207743 | 158 | ![]() |
lung | 53 / 336974 | 157 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 2 / 91610 | 21 | ![]() |
mammary gland | 18 / 153271 | 117 | ![]() |
mouth | 14 / 67052 | 208 | ![]() |
muscle | 3 / 107715 | 27 | ![]() |
nerve | 2 / 15768 | 126 | ![]() |
ovary | 2 / 102051 | 19 | ![]() |
pancreas | 9 / 214812 | 41 | ![]() |
parathyroid | 3 / 20539 | 146 | ![]() |
pharynx | 4 / 41328 | 96 | ![]() |
pituitary gland | 2 / 16585 | 120 | ![]() |
placenta | 117 / 280825 | 416 | ![]() |
prostate | 12 / 189345 | 63 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 26 / 210574 | 123 | ![]() |
spleen | 11 / 53952 | 203 | ![]() |
stomach | 21 / 96619 | 217 | ![]() |
testis | 60 / 330442 | 181 | ![]() |
thymus | 38 / 81131 | 468 | ![]() |
thyroid | 2 / 47473 | 42 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 17 / 52413 | 324 | ![]() |
umbilical cord | 5 / 13680 | 365 | ![]() |
uterus | 37 / 232878 | 158 | ![]() |
vascular | 19 / 51780 | 366 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201060_x_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 13.4 | ![]() |
Adipocyte | 154.5 | ![]() |
AdrenalCortex | 10.05 | ![]() |
Adrenalgland | 9 | ![]() |
Amygdala | 12.55 | ![]() |
Appendix | 26.45 | ![]() |
AtrioventricularNode | 17.2 | ![]() |
BDCA4+_DentriticCells | 6.9 | ![]() |
Bonemarrow | 93.95 | ![]() |
BronchialEpithelialCells | 37.05 | ![]() |
CD105+_Endothelial | 37.95 | ![]() |
CD14+_Monocytes | 9.35 | ![]() |
CD19+_BCells(neg._sel.) | 2.85 | ![]() |
CD33+_Myeloid | 9.35 | ![]() |
CD34+ | 17 | ![]() |
CD4+_Tcells | 21.95 | ![]() |
CD56+_NKCells | 72.9 | ![]() |
CD71+_EarlyErythroid | 362.75 | ![]() |
CD8+_Tcells | 22.05 | ![]() |
CardiacMyocytes | 16.6 | ![]() |
Caudatenucleus | 10.4 | ![]() |
Cerebellum | 7.1 | ![]() |
CerebellumPeduncles | 5.5 | ![]() |
CiliaryGanglion | 15.15 | ![]() |
CingulateCortex | 8.1 | ![]() |
Colorectaladenocarcinoma | 2.35 | ![]() |
DorsalRootGanglion | 14.15 | ![]() |
FetalThyroid | 7.85 | ![]() |
Fetalbrain | 5 | ![]() |
Fetalliver | 72.1 | ![]() |
Fetallung | 68.2 | ![]() |
GlobusPallidus | 4.75 | ![]() |
Heart | 11.6 | ![]() |
Hypothalamus | 12.2 | ![]() |
Kidney | 11.7 | ![]() |
Leukemia_chronicMyelogenousK-562 | 7.6 | ![]() |
Leukemia_promyelocytic-HL-60 | 2.7 | ![]() |
Leukemialymphoblastic(MOLT-4) | 2.8 | ![]() |
Liver | 13.65 | ![]() |
Lung | 30.45 | ![]() |
Lymphnode | 19.2 | ![]() |
Lymphoma_burkitts(Daudi) | 7.55 | ![]() |
Lymphoma_burkitts(Raji) | 3.05 | ![]() |
MedullaOblongata | 4.55 | ![]() |
OccipitalLobe | 7.3 | ![]() |
OlfactoryBulb | 40.65 | ![]() |
Ovary | 12.25 | ![]() |
Pancreas | 3.05 | ![]() |
PancreaticIslet | 6.1 | ![]() |
ParietalLobe | 5.2 | ![]() |
Pituitary | 10.4 | ![]() |
Placenta | 93.7 | ![]() |
Pons | 6.15 | ![]() |
PrefrontalCortex | 16.7 | ![]() |
Prostate | 6.95 | ![]() |
Salivarygland | 11.25 | ![]() |
SkeletalMuscle | 4.75 | ![]() |
Skin | 10.75 | ![]() |
SmoothMuscle | 41.05 | ![]() |
Spinalcord | 21.3 | ![]() |
SubthalamicNucleus | 5.7 | ![]() |
SuperiorCervicalGanglion | 8.75 | ![]() |
TemporalLobe | 4.25 | ![]() |
Testis | 6.15 | ![]() |
TestisGermCell | 8.1 | ![]() |
TestisIntersitial | 5.75 | ![]() |
TestisLeydigCell | 9.15 | ![]() |
TestisSeminiferousTubule | 6.55 | ![]() |
Thalamus | 8.65 | ![]() |
Thymus | 7.4 | ![]() |
Thyroid | 10.15 | ![]() |
Tongue | 7.9 | ![]() |
Tonsil | 5.7 | ![]() |
Trachea | 9.25 | ![]() |
TrigeminalGanglion | 7.9 | ![]() |
Uterus | 14.55 | ![]() |
UterusCorpus | 20.2 | ![]() |
WholeBlood | 12.3 | ![]() |
Wholebrain | 6.75 | ![]() |
colon | 14.75 | ![]() |
pineal_day | 16.24 | ![]() |
pineal_night | 9.4 | ![]() |
retina | 39.725 | ![]() |
small_intestine | 14.15 | ![]() |
- Probe name: A_23_P255263
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.44 ± 0.55 | ![]() ![]() ![]() |
Basal Forebrain | 5.63 ± 0.29 | ![]() ![]() ![]() |
Basal Part of Pons | 4.58 ± 0.73 | ![]() ![]() ![]() |
Cerebellar Cortex | 4.78 ± 0.23 | ![]() ![]() ![]() |
Cerebellar Nuclei | 5.26 ± 0.78 | ![]() ![]() ![]() |
Claustrum | 4.44 ± 0.55 | ![]() ![]() ![]() |
Epithalamus | 5.75 ± 0.55 | ![]() ![]() ![]() |
Frontal Lobe | 5.15 ± 0.52 | ![]() ![]() ![]() |
Globus Pallidus | 6.69 ± 0.46 | ![]() ![]() ![]() |
Hypothalamus | 5.5 ± 0.5 | ![]() ![]() ![]() |
Insula | 5.3 ± 0.45 | ![]() ![]() ![]() |
Limbic Lobe | 5.02 ± 0.63 | ![]() ![]() ![]() |
Mesencephalon | 5.49 ± 0.63 | ![]() ![]() ![]() |
Myelencephalon | 5.37 ± 0.62 | ![]() ![]() ![]() |
Occipital Lobe | 5.36 ± 0.43 | ![]() ![]() ![]() |
Parietal Lobe | 5.11 ± 0.59 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.52 ± 0.41 | ![]() ![]() ![]() |
Striatum | 6.58 ± 0.53 | ![]() ![]() ![]() |
Subthalamus | 4.82 ± 0.23 | ![]() ![]() ![]() |
Temporal Lobe | 5.23 ± 0.44 | ![]() ![]() ![]() |
Thalamus | 5.69 ± 0.44 | ![]() ![]() ![]() |
White Matter | 5.01 ± 0.38 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Stom | CB | Cerebellum | 100 | ![]() |
100 | ![]() | |||
Stom | CTX | Cerebral cortex | 100 | ![]() |
100 | ![]() | |||
Stom | HIP | Hippocampal region | 100 | ![]() |
100 | ![]() | |||
Stom | HPF | Hippocampal formation | 100 | ![]() |
100 | ![]() | |||
Stom | HY | Hypothalamus | 77.57 | ![]() |
74.76 | ![]() | |||
Stom | LSX | Lateral septal complex | 100 | ![]() |
100 | ![]() | |||
Stom | MB | Midbrain | 61.9 | ![]() |
60.96 | ![]() | |||
Stom | MY | Medulla | 71.4 | ![]() |
84.94 | ![]() | |||
Stom | OLF | Olfactory bulb | 100 | ![]() |
100 | ![]() | |||
Stom | P | Pons | 62.76 | ![]() |
74.16 | ![]() | |||
Stom | PAL | Pallidum | 70.92 | ![]() |
73.45 | ![]() | |||
Stom | RHP | Retrohippocampal region | 100 | ![]() |
100 | ![]() | |||
Stom | sAMY | Striatum-like amygdalar nuclei | 100 | ![]() |
87.25 | ![]() | |||
Stom | STR | Striatum | 100 | ![]() |
84.41 | ![]() | |||
Stom | STRd | Striatum dorsal region | 92.93 | ![]() |
76.77 | ![]() | |||
Stom | STRv | Striatum ventral region | 100 | ![]() |
100 | ![]() | |||
Stom | TH | Thalamus | 65.01 | ![]() |
59.85 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00003038 | 16 | 78 | 93 | GPGLFFILPCTDSFIK | Peptide Atlas |
STOM_HUMAN_125 | 19 | 125 | 143 | VQNATLAVANITNADSATR | PRIDE |
STOM_HUMAN_144 | 8 | 144 | 151 | LLAQTTLR | PRIDE |
STOM_HUMAN_158 | 33 | 158 | 190 | NLSQILSDREEIAHNMQSTLDDATDAWGIKVER | PRIDE |
STOM_HUMAN_195 | 10 | 195 | 204 | DVKLPVQLQR | PRIDE |
STOM_HUMAN_205 | 10 | 205 | 214 | AMAAEAEASR | PRIDE |
STOM_HUMAN_218 | 14 | 218 | 231 | AKVIAAEGEMNASR | PRIDE |
STOM_HUMAN_220 | 12 | 220 | 231 | VIAAEGEMNASR | PRIDE |
STOM_HUMAN_232 | 19 | 232 | 250 | ALKEASMVITESPAALQLR | PRIDE |
STOM_HUMAN_235 | 16 | 235 | 250 | EASMVITESPAALQLR | PRIDE |
STOM_HUMAN_251 | 12 | 251 | 262 | YLQTLTTIAAEK | PRIDE |
STOM_HUMAN_263 | 20 | 263 | 282 | NSTIVFPLPIDMLQGIIGAK | PRIDE |
STOM_HUMAN_77 | 16 | 77 | 92 | GPGLFFILPCTDSFIK | PRIDE |
STOM_HUMAN_97 | 14 | 97 | 110 | TISFDIPPQEILTK | PRIDE |