Annotation Detail for EPHA3
Basic Information Top
Gene Symbol: | EPHA3 ( EK4,ETK,ETK1,HEK,HEK4,TYRO4 ) |
---|---|
Gene Full Name: | EPH receptor A3 |
Band: | 3p11.1 |
Quick Links | Entrez ID:2042; OMIM: 179611; Uniprot ID:EPHA3_HUMAN; ENSEMBL ID: ENSG00000044524; HGNC ID: 3387 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.123642
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 32 / 564012 | 56 | |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 1 / 55556 | 17 | |
adult | 23 / 1939121 | 11 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 1 / 82823 | 12 | |
colorectal tumor | 0 / 114246 | 0 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 1 / 263845 | 3 | |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 1 / 97250 | 10 | |
normal | 58 / 3360307 | 17 | |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 1 / 104616 | 9 | |
primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | |
prostate cancer | 3 / 102680 | 29 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 3 / 124949 | 24 | |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 0 / 123478 | 0 | |
bone | 0 / 71655 | 0 | |
bone marrow | 0 / 48801 | 0 | |
brain | 34 / 1100989 | 30 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 2 / 149255 | 13 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 0 / 20209 | 0 | |
eye | 1 / 211054 | 4 | |
heart | 0 / 89626 | 0 | |
intestine | 1 / 234472 | 4 | |
kidney | 1 / 211777 | 4 | |
larynx | 0 / 24145 | 0 | |
liver | 0 / 207743 | 0 | |
lung | 1 / 336974 | 2 | |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 1 / 153271 | 6 | |
mouth | 1 / 67052 | 14 | |
muscle | 2 / 107715 | 18 | |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 1 / 214812 | 4 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 7 / 280825 | 24 | |
prostate | 8 / 189345 | 42 | |
salivary gland | 0 / 20155 | 0 | |
skin | 3 / 210574 | 14 | |
spleen | 1 / 53952 | 18 | |
stomach | 0 / 96619 | 0 | |
testis | 3 / 330442 | 9 | |
thymus | 0 / 81131 | 0 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 3 / 52413 | 57 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 1 / 232878 | 4 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 206071_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 7 | |
Adipocyte | 5.5 | |
AdrenalCortex | 6.8 | |
Adrenalgland | 4.75 | |
Amygdala | 5.55 | |
Appendix | 5.65 | |
AtrioventricularNode | 4.8 | |
BDCA4+_DentriticCells | 5.5 | |
Bonemarrow | 5.55 | |
BronchialEpithelialCells | 5.3 | |
CD105+_Endothelial | 5.25 | |
CD14+_Monocytes | 5.75 | |
CD19+_BCells(neg._sel.) | 5.9 | |
CD33+_Myeloid | 6.9 | |
CD34+ | 6.5 | |
CD4+_Tcells | 5.6 | |
CD56+_NKCells | 6.1 | |
CD71+_EarlyErythroid | 5.2 | |
CD8+_Tcells | 5.05 | |
CardiacMyocytes | 8.8 | |
Caudatenucleus | 4.95 | |
Cerebellum | 4.45 | |
CerebellumPeduncles | 7.05 | |
CiliaryGanglion | 3.95 | |
CingulateCortex | 5.85 | |
Colorectaladenocarcinoma | 5.35 | |
DorsalRootGanglion | 4.8 | |
FetalThyroid | 5.4 | |
Fetalbrain | 7.7 | |
Fetalliver | 4.7 | |
Fetallung | 4.35 | |
GlobusPallidus | 4.1 | |
Heart | 7.4 | |
Hypothalamus | 5.95 | |
Kidney | 4.95 | |
Leukemia_chronicMyelogenousK-562 | 5 | |
Leukemia_promyelocytic-HL-60 | 5.85 | |
Leukemialymphoblastic(MOLT-4) | 4.45 | |
Liver | 8.25 | |
Lung | 6.1 | |
Lymphnode | 4.75 | |
Lymphoma_burkitts(Daudi) | 7.9 | |
Lymphoma_burkitts(Raji) | 8.35 | |
MedullaOblongata | 4.85 | |
OccipitalLobe | 4.95 | |
OlfactoryBulb | 4.3 | |
Ovary | 3.9 | |
Pancreas | 4.4 | |
PancreaticIslet | 6 | |
ParietalLobe | 6.6 | |
Pituitary | 6.5 | |
Placenta | 5.55 | |
Pons | 5.25 | |
PrefrontalCortex | 6.75 | |
Prostate | 6.55 | |
Salivarygland | 4.4 | |
SkeletalMuscle | 7.8 | |
Skin | 4.55 | |
SmoothMuscle | 6.9 | |
Spinalcord | 5.85 | |
SubthalamicNucleus | 5.1 | |
SuperiorCervicalGanglion | 7.2 | |
TemporalLobe | 5.1 | |
Testis | 4.7 | |
TestisGermCell | 4.55 | |
TestisIntersitial | 4.8 | |
TestisLeydigCell | 5.65 | |
TestisSeminiferousTubule | 4.65 | |
Thalamus | 5.65 | |
Thymus | 4.2 | |
Thyroid | 6.85 | |
Tongue | 6.85 | |
Tonsil | 5.65 | |
Trachea | 4.6 | |
TrigeminalGanglion | 6.15 | |
Uterus | 4.55 | |
UterusCorpus | 5.45 | |
WholeBlood | 5.95 | |
Wholebrain | 4.6 | |
colon | 5.4 | |
pineal_day | 6.6 | |
pineal_night | 6.54 | |
retina | 6.45 | |
small_intestine | 5.2 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_23_P147046
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 4.99 ± 0.59 | |
Basal Forebrain | 4.69 ± 0.45 | |
Basal Part of Pons | 5.93 ± 0.24 | |
Cerebellar Cortex | 4.21 ± 0.65 | |
Cerebellar Nuclei | 4.48 ± 0.47 | |
Claustrum | 4.3 ± 0.86 | |
Epithalamus | 4.14 ± 0.74 | |
Frontal Lobe | 4.48 ± 0.61 | |
Globus Pallidus | 3.75 ± 0.97 | |
Hypothalamus | 5 ± 0.48 | |
Insula | 4.65 ± 0.32 | |
Limbic Lobe | 4.53 ± 0.68 | |
Mesencephalon | 4.8 ± 0.71 | |
Myelencephalon | 4.71 ± 0.73 | |
Occipital Lobe | 5.61 ± 0.44 | |
Parietal Lobe | 4.75 ± 0.67 | |
Pontine Tegmentum | 4.54 ± 0.68 | |
Striatum | 4.21 ± 0.94 | |
Subthalamus | 4.14 ± 0.43 | |
Temporal Lobe | 5.19 ± 0.44 | |
Thalamus | 5.12 ± 0.83 | |
White Matter | 3.24 ± 0.98 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Epha3 | CB | Cerebellum | 2.64 | |
2.63 | ||||
Epha3 | CTX | Cerebral cortex | 6.8 | |
4.66 | ||||
Epha3 | HIP | Hippocampal region | 10.6 | |
11.13 | ||||
Epha3 | HPF | Hippocampal formation | 11.82 | |
11.13 | ||||
Epha3 | HY | Hypothalamus | 1.37 | |
1.1 | ||||
Epha3 | LSX | Lateral septal complex | 4.2 | |
3.16 | ||||
Epha3 | MB | Midbrain | 2.45 | |
2.42 | ||||
Epha3 | MY | Medulla | 6.67 | |
7.35 | ||||
Epha3 | OLF | Olfactory bulb | 17.31 | |
13.63 | ||||
Epha3 | P | Pons | 6 | |
6.45 | ||||
Epha3 | PAL | Pallidum | 4.31 | |
3.6 | ||||
Epha3 | RHP | Retrohippocampal region | 14.56 | |
11.77 | ||||
Epha3 | sAMY | Striatum-like amygdalar nuclei | 2.97 | |
2.35 | ||||
Epha3 | STR | Striatum | 2.6 | |
1.8 | ||||
Epha3 | STRd | Striatum dorsal region | 2.36 | |
1.65 | ||||
Epha3 | STRv | Striatum ventral region | 2.61 | |
1.54 | ||||
Epha3 | TH | Thalamus | 4.06 | |
3.19 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00042842 | 30 | 37 | 66 | TIQGELGWISYPSHGWEEISGVDEHYTPIR | Peptide Atlas |