Annotation Detail for EPHX1


Gene Symbol: | EPHX1 ( EPHX,EPOX,MEH ) |
---|---|
Gene Full Name: | epoxide hydrolase 1, microsomal (xenobiotic) |
Band: | 1q42.12 |
Quick Links | Entrez ID:2052; OMIM: 132810; Uniprot ID:HYEP_HUMAN; ENSEMBL ID: ENSG00000143819; HGNC ID: 3401 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.89649
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 1 / 70761 | 14 | ![]() |
blastocyst | 5 / 62319 | 80 | ![]() |
fetus | 15 / 564012 | 26 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 1 / 23620 | 42 | ![]() |
juvenile | 1 / 55556 | 17 | ![]() |
adult | 175 / 1939121 | 90 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 6 / 12794 | 468 | ![]() |
bladder carcinoma | 1 / 17475 | 57 | ![]() |
breast (mammary gland) tumor | 4 / 94178 | 42 | ![]() |
cervical tumor | 2 / 34366 | 58 | ![]() |
chondrosarcoma | 16 / 82823 | 193 | ![]() |
colorectal tumor | 8 / 114246 | 70 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 5 / 119369 | 41 | ![]() |
germ cell tumor | 5 / 263845 | 18 | ![]() |
glioma | 11 / 106883 | 102 | ![]() |
head and neck tumor | 8 / 136302 | 58 | ![]() |
kidney tumor | 7 / 68959 | 101 | ![]() |
leukemia | 4 / 95842 | 41 | ![]() |
liver tumor | 8 / 96359 | 83 | ![]() |
lung tumor | 44 / 103127 | 426 | ![]() |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 6 / 97250 | 61 | ![]() |
normal | 214 / 3360307 | 63 | ![]() |
ovarian tumor | 13 / 76682 | 169 | ![]() |
pancreatic tumor | 15 / 104616 | 143 | ![]() |
primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | ![]() |
prostate cancer | 12 / 102680 | 116 | ![]() |
retinoblastoma | 5 / 46356 | 107 | ![]() |
skin tumor | 18 / 124949 | 144 | ![]() |
soft tissue/muscle tissue tumor | 4 / 125191 | 31 | ![]() |
uterine tumor | 18 / 90257 | 199 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 4 / 13106 | 305 | ![]() |
adrenal gland | 20 / 33197 | 602 | ![]() |
ascites | 0 / 40015 | 0 | |
bladder | 1 / 29757 | 33 | ![]() |
blood | 5 / 123478 | 40 | ![]() |
bone | 8 / 71655 | 111 | ![]() |
bone marrow | 0 / 48801 | 0 | |
brain | 70 / 1100989 | 63 | ![]() |
cervix | 3 / 48171 | 62 | ![]() |
connective tissue | 13 / 149255 | 87 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 9 / 215722 | 41 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 33 / 211054 | 156 | ![]() |
heart | 3 / 89626 | 33 | ![]() |
intestine | 15 / 234472 | 63 | ![]() |
kidney | 9 / 211777 | 42 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 17 / 207743 | 81 | ![]() |
lung | 79 / 336974 | 234 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 10 / 153271 | 65 | ![]() |
mouth | 1 / 67052 | 14 | ![]() |
muscle | 6 / 107715 | 55 | ![]() |
nerve | 1 / 15768 | 63 | ![]() |
ovary | 16 / 102051 | 156 | ![]() |
pancreas | 25 / 214812 | 116 | ![]() |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 1 / 41328 | 24 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 12 / 280825 | 42 | ![]() |
prostate | 18 / 189345 | 95 | ![]() |
salivary gland | 9 / 20155 | 446 | ![]() |
skin | 22 / 210574 | 104 | ![]() |
spleen | 4 / 53952 | 74 | ![]() |
stomach | 3 / 96619 | 31 | ![]() |
testis | 8 / 330442 | 24 | ![]() |
thymus | 5 / 81131 | 61 | ![]() |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 3 / 52413 | 57 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 18 / 232878 | 77 | ![]() |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202017_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 11.75 | ![]() |
Adipocyte | 1675 | ![]() |
AdrenalCortex | 1553.25 | ![]() |
Adrenalgland | 4259.7 | ![]() |
Amygdala | 265.1 | ![]() |
Appendix | 156 | ![]() |
AtrioventricularNode | 111.5 | ![]() |
BDCA4+_DentriticCells | 5.75 | ![]() |
Bonemarrow | 35 | ![]() |
BronchialEpithelialCells | 35.7 | ![]() |
CD105+_Endothelial | 76.2 | ![]() |
CD14+_Monocytes | 37.75 | ![]() |
CD19+_BCells(neg._sel.) | 4.85 | ![]() |
CD33+_Myeloid | 35.65 | ![]() |
CD34+ | 11 | ![]() |
CD4+_Tcells | 9.1 | ![]() |
CD56+_NKCells | 5.85 | ![]() |
CD71+_EarlyErythroid | 5.9 | ![]() |
CD8+_Tcells | 4.3 | ![]() |
CardiacMyocytes | 90.2 | ![]() |
Caudatenucleus | 187.2 | ![]() |
Cerebellum | 98.3 | ![]() |
CerebellumPeduncles | 113.4 | ![]() |
CiliaryGanglion | 123.45 | ![]() |
CingulateCortex | 127.3 | ![]() |
Colorectaladenocarcinoma | 212.7 | ![]() |
DorsalRootGanglion | 95 | ![]() |
FetalThyroid | 219.05 | ![]() |
Fetalbrain | 39.85 | ![]() |
Fetalliver | 413.4 | ![]() |
Fetallung | 125.7 | ![]() |
GlobusPallidus | 81.1 | ![]() |
Heart | 278.55 | ![]() |
Hypothalamus | 151.85 | ![]() |
Kidney | 326.7 | ![]() |
Leukemia_chronicMyelogenousK-562 | 13.5 | ![]() |
Leukemia_promyelocytic-HL-60 | 15.25 | ![]() |
Leukemialymphoblastic(MOLT-4) | 15.55 | ![]() |
Liver | 7077.55 | ![]() |
Lung | 1075.6 | ![]() |
Lymphnode | 147.6 | ![]() |
Lymphoma_burkitts(Daudi) | 13.75 | ![]() |
Lymphoma_burkitts(Raji) | 25.25 | ![]() |
MedullaOblongata | 128.5 | ![]() |
OccipitalLobe | 123.8 | ![]() |
OlfactoryBulb | 365.95 | ![]() |
Ovary | 200.5 | ![]() |
Pancreas | 100.45 | ![]() |
PancreaticIslet | 174 | ![]() |
ParietalLobe | 128.65 | ![]() |
Pituitary | 170.85 | ![]() |
Placenta | 76.1 | ![]() |
Pons | 130 | ![]() |
PrefrontalCortex | 606.8 | ![]() |
Prostate | 282.5 | ![]() |
Salivarygland | 79.45 | ![]() |
SkeletalMuscle | 122 | ![]() |
Skin | 57.75 | ![]() |
SmoothMuscle | 35.9 | ![]() |
Spinalcord | 267.5 | ![]() |
SubthalamicNucleus | 58.45 | ![]() |
SuperiorCervicalGanglion | 156.5 | ![]() |
TemporalLobe | 82.95 | ![]() |
Testis | 194.8 | ![]() |
TestisGermCell | 198.1 | ![]() |
TestisIntersitial | 158.35 | ![]() |
TestisLeydigCell | 180.85 | ![]() |
TestisSeminiferousTubule | 157.05 | ![]() |
Thalamus | 266.35 | ![]() |
Thymus | 93.95 | ![]() |
Thyroid | 777.3 | ![]() |
Tongue | 127.05 | ![]() |
Tonsil | 64.15 | ![]() |
Trachea | 230.15 | ![]() |
TrigeminalGanglion | 170.25 | ![]() |
Uterus | 263.8 | ![]() |
UterusCorpus | 108.3 | ![]() |
WholeBlood | 17 | ![]() |
Wholebrain | 162.75 | ![]() |
colon | 113.05 | ![]() |
pineal_day | 733.4 | ![]() |
pineal_night | 498.72 | ![]() |
retina | 501.8 | ![]() |
small_intestine | 150.25 | ![]() |
- Probe name: CUST_15680_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 4.89 ± 0.44 | ![]() ![]() ![]() |
Basal Forebrain | 5.08 ± 0.15 | ![]() ![]() ![]() |
Basal Part of Pons | 5.43 ± 0.38 | ![]() ![]() ![]() |
Cerebellar Cortex | 4.85 ± 0.31 | ![]() ![]() ![]() |
Cerebellar Nuclei | 5.11 ± 0.49 | ![]() ![]() ![]() |
Claustrum | 4.18 ± 0.43 | ![]() ![]() ![]() |
Epithalamus | 5.6 ± 0.6 | ![]() ![]() ![]() |
Frontal Lobe | 5.22 ± 0.47 | ![]() ![]() ![]() |
Globus Pallidus | 6.25 ± 0.37 | ![]() ![]() ![]() |
Hypothalamus | 5 ± 0.38 | ![]() ![]() ![]() |
Insula | 5.23 ± 0.35 | ![]() ![]() ![]() |
Limbic Lobe | 5.24 ± 0.46 | ![]() ![]() ![]() |
Mesencephalon | 5.34 ± 0.4 | ![]() ![]() ![]() |
Myelencephalon | 5.26 ± 0.54 | ![]() ![]() ![]() |
Occipital Lobe | 5.03 ± 0.49 | ![]() ![]() ![]() |
Parietal Lobe | 5.15 ± 0.48 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.24 ± 0.57 | ![]() ![]() ![]() |
Striatum | 5.81 ± 0.43 | ![]() ![]() ![]() |
Subthalamus | 4.74 ± 0.34 | ![]() ![]() ![]() |
Temporal Lobe | 5.27 ± 0.41 | ![]() ![]() ![]() |
Thalamus | 5.64 ± 0.46 | ![]() ![]() ![]() |
White Matter | 6.03 ± 0.3 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Ephx1 | CB | Cerebellum | 14.3 | ![]() |
16.15 | ![]() | |||
Ephx1 | CTX | Cerebral cortex | 22.95 | ![]() |
17.52 | ![]() | |||
Ephx1 | HIP | Hippocampal region | 22.98 | ![]() |
32.59 | ![]() | |||
Ephx1 | HPF | Hippocampal formation | 21.97 | ![]() |
25.53 | ![]() | |||
Ephx1 | HY | Hypothalamus | 10.28 | ![]() |
10.14 | ![]() | |||
Ephx1 | LSX | Lateral septal complex | 15.31 | ![]() |
14.38 | ![]() | |||
Ephx1 | MB | Midbrain | 7.75 | ![]() |
10.46 | ![]() | |||
Ephx1 | MY | Medulla | 17.37 | ![]() |
23.63 | ![]() | |||
Ephx1 | OLF | Olfactory bulb | 22.44 | ![]() |
18.09 | ![]() | |||
Ephx1 | P | Pons | 14.06 | ![]() |
19.41 | ![]() | |||
Ephx1 | PAL | Pallidum | 7.3 | ![]() |
5.98 | ![]() | |||
Ephx1 | RHP | Retrohippocampal region | 20.46 | ![]() |
16.34 | ![]() | |||
Ephx1 | sAMY | Striatum-like amygdalar nuclei | 25.83 | ![]() |
19.19 | ![]() | |||
Ephx1 | STR | Striatum | 23.71 | ![]() |
16.32 | ![]() | |||
Ephx1 | STRd | Striatum dorsal region | 24.93 | ![]() |
16.41 | ![]() | |||
Ephx1 | STRv | Striatum ventral region | 23.39 | ![]() |
15.26 | ![]() | |||
Ephx1 | TH | Thalamus | 8.5 | ![]() |
12.56 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
HYEP_HUMAN_428 | 18 | 428 | 445 | GGHFAAFEEPELLAQDIR | PRIDE |
HYEP_HUMAN_58 | 9 | 58 | 66 | EEIHDLHQR | PRIDE |
PAp00002231 | 33 | 296 | 328 | ESGYMHIQCTKPDTVGSALNDSPVGLAAYILEK | Peptide Atlas |