Annotation Detail for EPHX1
Basic Information Top
| Gene Symbol: | EPHX1 ( EPHX,EPOX,MEH ) |
|---|---|
| Gene Full Name: | epoxide hydrolase 1, microsomal (xenobiotic) |
| Band: | 1q42.12 |
| Quick Links | Entrez ID:2052; OMIM: 132810; Uniprot ID:HYEP_HUMAN; ENSEMBL ID: ENSG00000143819; HGNC ID: 3401 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.89649
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 1 / 70761 | 14 | |
| blastocyst | 5 / 62319 | 80 | |
| fetus | 15 / 564012 | 26 | |
| neonate | 0 / 31097 | 0 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 175 / 1939121 | 90 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 6 / 12794 | 468 | |
| bladder carcinoma | 1 / 17475 | 57 | |
| breast (mammary gland) tumor | 4 / 94178 | 42 | |
| cervical tumor | 2 / 34366 | 58 | |
| chondrosarcoma | 16 / 82823 | 193 | |
| colorectal tumor | 8 / 114246 | 70 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 5 / 119369 | 41 | |
| germ cell tumor | 5 / 263845 | 18 | |
| glioma | 11 / 106883 | 102 | |
| head and neck tumor | 8 / 136302 | 58 | |
| kidney tumor | 7 / 68959 | 101 | |
| leukemia | 4 / 95842 | 41 | |
| liver tumor | 8 / 96359 | 83 | |
| lung tumor | 44 / 103127 | 426 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 6 / 97250 | 61 | |
| normal | 214 / 3360307 | 63 | |
| ovarian tumor | 13 / 76682 | 169 | |
| pancreatic tumor | 15 / 104616 | 143 | |
| primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | |
| prostate cancer | 12 / 102680 | 116 | |
| retinoblastoma | 5 / 46356 | 107 | |
| skin tumor | 18 / 124949 | 144 | |
| soft tissue/muscle tissue tumor | 4 / 125191 | 31 | |
| uterine tumor | 18 / 90257 | 199 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 4 / 13106 | 305 | |
| adrenal gland | 20 / 33197 | 602 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 1 / 29757 | 33 | |
| blood | 5 / 123478 | 40 | |
| bone | 8 / 71655 | 111 | |
| bone marrow | 0 / 48801 | 0 | |
| brain | 70 / 1100989 | 63 | |
| cervix | 3 / 48171 | 62 | |
| connective tissue | 13 / 149255 | 87 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 9 / 215722 | 41 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 33 / 211054 | 156 | |
| heart | 3 / 89626 | 33 | |
| intestine | 15 / 234472 | 63 | |
| kidney | 9 / 211777 | 42 | |
| larynx | 0 / 24145 | 0 | |
| liver | 17 / 207743 | 81 | |
| lung | 79 / 336974 | 234 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 10 / 153271 | 65 | |
| mouth | 1 / 67052 | 14 | |
| muscle | 6 / 107715 | 55 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 16 / 102051 | 156 | |
| pancreas | 25 / 214812 | 116 | |
| parathyroid | 1 / 20539 | 48 | |
| pharynx | 1 / 41328 | 24 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 12 / 280825 | 42 | |
| prostate | 18 / 189345 | 95 | |
| salivary gland | 9 / 20155 | 446 | |
| skin | 22 / 210574 | 104 | |
| spleen | 4 / 53952 | 74 | |
| stomach | 3 / 96619 | 31 | |
| testis | 8 / 330442 | 24 | |
| thymus | 5 / 81131 | 61 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 3 / 52413 | 57 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 18 / 232878 | 77 | |
| vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202017_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 11.75 | |
| Adipocyte | 1675 | |
| AdrenalCortex | 1553.25 | |
| Adrenalgland | 4259.7 | |
| Amygdala | 265.1 | |
| Appendix | 156 | |
| AtrioventricularNode | 111.5 | |
| BDCA4+_DentriticCells | 5.75 | |
| Bonemarrow | 35 | |
| BronchialEpithelialCells | 35.7 | |
| CD105+_Endothelial | 76.2 | |
| CD14+_Monocytes | 37.75 | |
| CD19+_BCells(neg._sel.) | 4.85 | |
| CD33+_Myeloid | 35.65 | |
| CD34+ | 11 | |
| CD4+_Tcells | 9.1 | |
| CD56+_NKCells | 5.85 | |
| CD71+_EarlyErythroid | 5.9 | |
| CD8+_Tcells | 4.3 | |
| CardiacMyocytes | 90.2 | |
| Caudatenucleus | 187.2 | |
| Cerebellum | 98.3 | |
| CerebellumPeduncles | 113.4 | |
| CiliaryGanglion | 123.45 | |
| CingulateCortex | 127.3 | |
| Colorectaladenocarcinoma | 212.7 | |
| DorsalRootGanglion | 95 | |
| FetalThyroid | 219.05 | |
| Fetalbrain | 39.85 | |
| Fetalliver | 413.4 | |
| Fetallung | 125.7 | |
| GlobusPallidus | 81.1 | |
| Heart | 278.55 | |
| Hypothalamus | 151.85 | |
| Kidney | 326.7 | |
| Leukemia_chronicMyelogenousK-562 | 13.5 | |
| Leukemia_promyelocytic-HL-60 | 15.25 | |
| Leukemialymphoblastic(MOLT-4) | 15.55 | |
| Liver | 7077.55 | |
| Lung | 1075.6 | |
| Lymphnode | 147.6 | |
| Lymphoma_burkitts(Daudi) | 13.75 | |
| Lymphoma_burkitts(Raji) | 25.25 | |
| MedullaOblongata | 128.5 | |
| OccipitalLobe | 123.8 | |
| OlfactoryBulb | 365.95 | |
| Ovary | 200.5 | |
| Pancreas | 100.45 | |
| PancreaticIslet | 174 | |
| ParietalLobe | 128.65 | |
| Pituitary | 170.85 | |
| Placenta | 76.1 | |
| Pons | 130 | |
| PrefrontalCortex | 606.8 | |
| Prostate | 282.5 | |
| Salivarygland | 79.45 | |
| SkeletalMuscle | 122 | |
| Skin | 57.75 | |
| SmoothMuscle | 35.9 | |
| Spinalcord | 267.5 | |
| SubthalamicNucleus | 58.45 | |
| SuperiorCervicalGanglion | 156.5 | |
| TemporalLobe | 82.95 | |
| Testis | 194.8 | |
| TestisGermCell | 198.1 | |
| TestisIntersitial | 158.35 | |
| TestisLeydigCell | 180.85 | |
| TestisSeminiferousTubule | 157.05 | |
| Thalamus | 266.35 | |
| Thymus | 93.95 | |
| Thyroid | 777.3 | |
| Tongue | 127.05 | |
| Tonsil | 64.15 | |
| Trachea | 230.15 | |
| TrigeminalGanglion | 170.25 | |
| Uterus | 263.8 | |
| UterusCorpus | 108.3 | |
| WholeBlood | 17 | |
| Wholebrain | 162.75 | |
| colon | 113.05 | |
| pineal_day | 733.4 | |
| pineal_night | 498.72 | |
| retina | 501.8 | |
| small_intestine | 150.25 |
- Probe name: CUST_15680_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 4.89 ± 0.44 | |
| Basal Forebrain | 5.08 ± 0.15 | |
| Basal Part of Pons | 5.43 ± 0.38 | |
| Cerebellar Cortex | 4.85 ± 0.31 | |
| Cerebellar Nuclei | 5.11 ± 0.49 | |
| Claustrum | 4.18 ± 0.43 | |
| Epithalamus | 5.6 ± 0.6 | |
| Frontal Lobe | 5.22 ± 0.47 | |
| Globus Pallidus | 6.25 ± 0.37 | |
| Hypothalamus | 5 ± 0.38 | |
| Insula | 5.23 ± 0.35 | |
| Limbic Lobe | 5.24 ± 0.46 | |
| Mesencephalon | 5.34 ± 0.4 | |
| Myelencephalon | 5.26 ± 0.54 | |
| Occipital Lobe | 5.03 ± 0.49 | |
| Parietal Lobe | 5.15 ± 0.48 | |
| Pontine Tegmentum | 5.24 ± 0.57 | |
| Striatum | 5.81 ± 0.43 | |
| Subthalamus | 4.74 ± 0.34 | |
| Temporal Lobe | 5.27 ± 0.41 | |
| Thalamus | 5.64 ± 0.46 | |
| White Matter | 6.03 ± 0.3 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Ephx1 | CB | Cerebellum | 14.3 | |
| 16.15 | ||||
| Ephx1 | CTX | Cerebral cortex | 22.95 | |
| 17.52 | ||||
| Ephx1 | HIP | Hippocampal region | 22.98 | |
| 32.59 | ||||
| Ephx1 | HPF | Hippocampal formation | 21.97 | |
| 25.53 | ||||
| Ephx1 | HY | Hypothalamus | 10.28 | |
| 10.14 | ||||
| Ephx1 | LSX | Lateral septal complex | 15.31 | |
| 14.38 | ||||
| Ephx1 | MB | Midbrain | 7.75 | |
| 10.46 | ||||
| Ephx1 | MY | Medulla | 17.37 | |
| 23.63 | ||||
| Ephx1 | OLF | Olfactory bulb | 22.44 | |
| 18.09 | ||||
| Ephx1 | P | Pons | 14.06 | |
| 19.41 | ||||
| Ephx1 | PAL | Pallidum | 7.3 | |
| 5.98 | ||||
| Ephx1 | RHP | Retrohippocampal region | 20.46 | |
| 16.34 | ||||
| Ephx1 | sAMY | Striatum-like amygdalar nuclei | 25.83 | |
| 19.19 | ||||
| Ephx1 | STR | Striatum | 23.71 | |
| 16.32 | ||||
| Ephx1 | STRd | Striatum dorsal region | 24.93 | |
| 16.41 | ||||
| Ephx1 | STRv | Striatum ventral region | 23.39 | |
| 15.26 | ||||
| Ephx1 | TH | Thalamus | 8.5 | |
| 12.56 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| HYEP_HUMAN_428 | 18 | 428 | 445 | GGHFAAFEEPELLAQDIR | PRIDE |
| HYEP_HUMAN_58 | 9 | 58 | 66 | EEIHDLHQR | PRIDE |
| PAp00002231 | 33 | 296 | 328 | ESGYMHIQCTKPDTVGSALNDSPVGLAAYILEK | Peptide Atlas |



