Annotation Detail for ALAD
Basic Information Top
| Gene Symbol: | ALAD ( ALADH,MGC5057,PBGS ) |
|---|---|
| Gene Full Name: | aminolevulinate dehydratase |
| Band: | 9q32 |
| Quick Links | Entrez ID:210; OMIM: 125270; Uniprot ID:HEM2_HUMAN; ENSEMBL ID: ENSG00000148218; HGNC ID: 395 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.1227
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 3 / 70761 | 42 | |
| blastocyst | 1 / 62319 | 16 | |
| fetus | 30 / 564012 | 53 | |
| neonate | 1 / 31097 | 32 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 83 / 1939121 | 42 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 10 / 94178 | 106 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 1 / 82823 | 12 | |
| colorectal tumor | 4 / 114246 | 35 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 4 / 119369 | 33 | |
| germ cell tumor | 8 / 263845 | 30 | |
| glioma | 3 / 106883 | 28 | |
| head and neck tumor | 9 / 136302 | 66 | |
| kidney tumor | 4 / 68959 | 58 | |
| leukemia | 7 / 95842 | 73 | |
| liver tumor | 2 / 96359 | 20 | |
| lung tumor | 4 / 103127 | 38 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 6 / 97250 | 61 | |
| normal | 230 / 3360307 | 68 | |
| ovarian tumor | 1 / 76682 | 13 | |
| pancreatic tumor | 1 / 104616 | 9 | |
| primitive neuroectodermal tumor of the CNS | 8 / 125680 | 63 | |
| prostate cancer | 0 / 102680 | 0 | |
| retinoblastoma | 1 / 46356 | 21 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 2 / 125191 | 15 | |
| uterine tumor | 1 / 90257 | 11 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 12 / 33197 | 361 | |
| ascites | 1 / 40015 | 24 | |
| bladder | 3 / 29757 | 100 | |
| blood | 9 / 123478 | 72 | |
| bone | 1 / 71655 | 13 | |
| bone marrow | 0 / 48801 | 0 | |
| brain | 134 / 1100989 | 121 | |
| cervix | 0 / 48171 | 0 | |
| connective tissue | 7 / 149255 | 46 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 5 / 215722 | 23 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 7 / 211054 | 33 | |
| heart | 2 / 89626 | 22 | |
| intestine | 11 / 234472 | 46 | |
| kidney | 10 / 211777 | 47 | |
| larynx | 0 / 24145 | 0 | |
| liver | 10 / 207743 | 48 | |
| lung | 9 / 336974 | 26 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 1 / 91610 | 10 | |
| mammary gland | 10 / 153271 | 65 | |
| mouth | 7 / 67052 | 104 | |
| muscle | 3 / 107715 | 27 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 1 / 102051 | 9 | |
| pancreas | 3 / 214812 | 13 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 1 / 41328 | 24 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 17 / 280825 | 60 | |
| prostate | 4 / 189345 | 21 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 5 / 210574 | 23 | |
| spleen | 4 / 53952 | 74 | |
| stomach | 4 / 96619 | 41 | |
| testis | 13 / 330442 | 39 | |
| thymus | 13 / 81131 | 160 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 3 / 52413 | 57 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 6 / 232878 | 25 | |
| vascular | 2 / 51780 | 38 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218487_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 29.7 | |
| Adipocyte | 23.6 | |
| AdrenalCortex | 49.7 | |
| Adrenalgland | 180.65 | |
| Amygdala | 72.35 | |
| Appendix | 19.1 | |
| AtrioventricularNode | 23.95 | |
| BDCA4+_DentriticCells | 37.8 | |
| Bonemarrow | 58.65 | |
| BronchialEpithelialCells | 15.95 | |
| CD105+_Endothelial | 417.75 | |
| CD14+_Monocytes | 41.75 | |
| CD19+_BCells(neg._sel.) | 31.55 | |
| CD33+_Myeloid | 57.6 | |
| CD34+ | 150.45 | |
| CD4+_Tcells | 35.1 | |
| CD56+_NKCells | 96.85 | |
| CD71+_EarlyErythroid | 788.15 | |
| CD8+_Tcells | 33.55 | |
| CardiacMyocytes | 28.45 | |
| Caudatenucleus | 41.5 | |
| Cerebellum | 40.3 | |
| CerebellumPeduncles | 36.3 | |
| CiliaryGanglion | 16.2 | |
| CingulateCortex | 49 | |
| Colorectaladenocarcinoma | 17.3 | |
| DorsalRootGanglion | 22.2 | |
| FetalThyroid | 24.7 | |
| Fetalbrain | 17.7 | |
| Fetalliver | 173.75 | |
| Fetallung | 16.3 | |
| GlobusPallidus | 38.4 | |
| Heart | 39.85 | |
| Hypothalamus | 129.8 | |
| Kidney | 75.7 | |
| Leukemia_chronicMyelogenousK-562 | 15.9 | |
| Leukemia_promyelocytic-HL-60 | 16.6 | |
| Leukemialymphoblastic(MOLT-4) | 18.9 | |
| Liver | 55.65 | |
| Lung | 20.95 | |
| Lymphnode | 19.35 | |
| Lymphoma_burkitts(Daudi) | 25.95 | |
| Lymphoma_burkitts(Raji) | 27.15 | |
| MedullaOblongata | 31.5 | |
| OccipitalLobe | 37.8 | |
| OlfactoryBulb | 95.1 | |
| Ovary | 12.7 | |
| Pancreas | 16 | |
| PancreaticIslet | 28.7 | |
| ParietalLobe | 42.7 | |
| Pituitary | 27.95 | |
| Placenta | 25.15 | |
| Pons | 31.15 | |
| PrefrontalCortex | 72.05 | |
| Prostate | 66.45 | |
| Salivarygland | 27.05 | |
| SkeletalMuscle | 25.5 | |
| Skin | 20.5 | |
| SmoothMuscle | 21.8 | |
| Spinalcord | 162.5 | |
| SubthalamicNucleus | 35.3 | |
| SuperiorCervicalGanglion | 43.4 | |
| TemporalLobe | 18.25 | |
| Testis | 20 | |
| TestisGermCell | 21.6 | |
| TestisIntersitial | 16.25 | |
| TestisLeydigCell | 19.1 | |
| TestisSeminiferousTubule | 15.75 | |
| Thalamus | 62.7 | |
| Thymus | 23.1 | |
| Thyroid | 71.15 | |
| Tongue | 18.8 | |
| Tonsil | 18.7 | |
| Trachea | 16.35 | |
| TrigeminalGanglion | 26.35 | |
| Uterus | 15.7 | |
| UterusCorpus | 17.4 | |
| WholeBlood | 20.1 | |
| Wholebrain | 88 | |
| colon | 46.15 | |
| pineal_day | 153.8 | |
| pineal_night | 124.06 | |
| retina | 161.25 | |
| small_intestine | 63.2 |
- Probe name: A_23_P324278
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 5.6 ± 0.46 | |
| Basal Forebrain | 6.24 ± 0.34 | |
| Basal Part of Pons | 6.16 ± 0.4 | |
| Cerebellar Cortex | 5.65 ± 0.18 | |
| Cerebellar Nuclei | 5.94 ± 0.49 | |
| Claustrum | 5.66 ± 0.47 | |
| Epithalamus | 6.08 ± 0.63 | |
| Frontal Lobe | 5.88 ± 0.4 | |
| Globus Pallidus | 7.14 ± 0.29 | |
| Hypothalamus | 6.08 ± 0.43 | |
| Insula | 5.58 ± 0.44 | |
| Limbic Lobe | 5.77 ± 0.45 | |
| Mesencephalon | 6.01 ± 0.53 | |
| Myelencephalon | 5.98 ± 0.44 | |
| Occipital Lobe | 5.95 ± 0.33 | |
| Parietal Lobe | 5.99 ± 0.42 | |
| Pontine Tegmentum | 5.91 ± 0.46 | |
| Striatum | 6.33 ± 0.4 | |
| Subthalamus | 5.97 ± 0.51 | |
| Temporal Lobe | 5.88 ± 0.35 | |
| Thalamus | 6.12 ± 0.36 | |
| White Matter | 7.3 ± 0.3 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Alad | CB | Cerebellum | 22.47 | |
| 19.04 | ||||
| Alad | CTX | Cerebral cortex | 100 | |
| 50.16 | ||||
| Alad | HIP | Hippocampal region | 53.81 | |
| 57.91 | ||||
| Alad | HPF | Hippocampal formation | 61.11 | |
| 47.53 | ||||
| Alad | HY | Hypothalamus | 100 | |
| 52.68 | ||||
| Alad | LSX | Lateral septal complex | 100 | |
| 70.85 | ||||
| Alad | MB | Midbrain | 52.12 | |
| 24.28 | ||||
| Alad | MY | Medulla | 44.4 | |
| 22.82 | ||||
| Alad | OLF | Olfactory bulb | 100 | |
| 64.7 | ||||
| Alad | P | Pons | 51.45 | |
| 25.31 | ||||
| Alad | PAL | Pallidum | 94.74 | |
| 46.94 | ||||
| Alad | RHP | Retrohippocampal region | 75.83 | |
| 35.3 | ||||
| Alad | sAMY | Striatum-like amygdalar nuclei | 100 | |
| 41.31 | ||||
| Alad | STR | Striatum | 89.49 | |
| 39.49 | ||||
| Alad | STRd | Striatum dorsal region | 69.53 | |
| 28.71 | ||||
| Alad | STRv | Striatum ventral region | 100 | |
| 58.99 | ||||
| Alad | TH | Thalamus | 88.13 | |
| 44.91 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| HEM2_HUMAN_149 | 10 | 149 | 158 | LAEVALAYAK | PRIDE |
| HEM2_HUMAN_243 | 19 | 243 | 261 | EGADMLMVKPGMPYLDIVR | PRIDE |
| HEM2_HUMAN_244 | 19 | 244 | 262 | EGADMLMVKPGMPYLDIVR | PRIDE |
| HEM2_HUMAN_265 | 32 | 265 | 296 | DKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLK | PRIDE |
| HEM2_HUMAN_297 | 11 | 297 | 307 | AAVLEAMTAFR | PRIDE |
| HEM2_HUMAN_59 | 15 | 59 | 73 | RLEEMLRPLVEEGLR | PRIDE |
| HEM2_HUMAN_90 | 19 | 90 | 108 | GSAADSEESPAIEAIHLLR | PRIDE |
| HEM2_HUMAN_91 | 19 | 91 | 109 | GSAADSEESPAIEAIHLLR | PRIDE |
| PAp00033788 | 10 | 209 | 218 | FASCFYGPFR | Peptide Atlas |



