Annotation Detail for ALAD


Gene Symbol: | ALAD ( ALADH,MGC5057,PBGS ) |
---|---|
Gene Full Name: | aminolevulinate dehydratase |
Band: | 9q32 |
Quick Links | Entrez ID:210; OMIM: 125270; Uniprot ID:HEM2_HUMAN; ENSEMBL ID: ENSG00000148218; HGNC ID: 395 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.1227
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 3 / 70761 | 42 | ![]() |
blastocyst | 1 / 62319 | 16 | ![]() |
fetus | 30 / 564012 | 53 | ![]() |
neonate | 1 / 31097 | 32 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 1 / 55556 | 17 | ![]() |
adult | 83 / 1939121 | 42 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 10 / 94178 | 106 | ![]() |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 1 / 82823 | 12 | ![]() |
colorectal tumor | 4 / 114246 | 35 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 4 / 119369 | 33 | ![]() |
germ cell tumor | 8 / 263845 | 30 | ![]() |
glioma | 3 / 106883 | 28 | ![]() |
head and neck tumor | 9 / 136302 | 66 | ![]() |
kidney tumor | 4 / 68959 | 58 | ![]() |
leukemia | 7 / 95842 | 73 | ![]() |
liver tumor | 2 / 96359 | 20 | ![]() |
lung tumor | 4 / 103127 | 38 | ![]() |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 6 / 97250 | 61 | ![]() |
normal | 230 / 3360307 | 68 | ![]() |
ovarian tumor | 1 / 76682 | 13 | ![]() |
pancreatic tumor | 1 / 104616 | 9 | ![]() |
primitive neuroectodermal tumor of the CNS | 8 / 125680 | 63 | ![]() |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 1 / 46356 | 21 | ![]() |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 2 / 125191 | 15 | ![]() |
uterine tumor | 1 / 90257 | 11 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 12 / 33197 | 361 | ![]() |
ascites | 1 / 40015 | 24 | ![]() |
bladder | 3 / 29757 | 100 | ![]() |
blood | 9 / 123478 | 72 | ![]() |
bone | 1 / 71655 | 13 | ![]() |
bone marrow | 0 / 48801 | 0 | |
brain | 134 / 1100989 | 121 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 7 / 149255 | 46 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 5 / 215722 | 23 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 7 / 211054 | 33 | ![]() |
heart | 2 / 89626 | 22 | ![]() |
intestine | 11 / 234472 | 46 | ![]() |
kidney | 10 / 211777 | 47 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 10 / 207743 | 48 | ![]() |
lung | 9 / 336974 | 26 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 1 / 91610 | 10 | ![]() |
mammary gland | 10 / 153271 | 65 | ![]() |
mouth | 7 / 67052 | 104 | ![]() |
muscle | 3 / 107715 | 27 | ![]() |
nerve | 1 / 15768 | 63 | ![]() |
ovary | 1 / 102051 | 9 | ![]() |
pancreas | 3 / 214812 | 13 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 1 / 41328 | 24 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 17 / 280825 | 60 | ![]() |
prostate | 4 / 189345 | 21 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 5 / 210574 | 23 | ![]() |
spleen | 4 / 53952 | 74 | ![]() |
stomach | 4 / 96619 | 41 | ![]() |
testis | 13 / 330442 | 39 | ![]() |
thymus | 13 / 81131 | 160 | ![]() |
thyroid | 2 / 47473 | 42 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 3 / 52413 | 57 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 6 / 232878 | 25 | ![]() |
vascular | 2 / 51780 | 38 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218487_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 29.7 | ![]() |
Adipocyte | 23.6 | ![]() |
AdrenalCortex | 49.7 | ![]() |
Adrenalgland | 180.65 | ![]() |
Amygdala | 72.35 | ![]() |
Appendix | 19.1 | ![]() |
AtrioventricularNode | 23.95 | ![]() |
BDCA4+_DentriticCells | 37.8 | ![]() |
Bonemarrow | 58.65 | ![]() |
BronchialEpithelialCells | 15.95 | ![]() |
CD105+_Endothelial | 417.75 | ![]() |
CD14+_Monocytes | 41.75 | ![]() |
CD19+_BCells(neg._sel.) | 31.55 | ![]() |
CD33+_Myeloid | 57.6 | ![]() |
CD34+ | 150.45 | ![]() |
CD4+_Tcells | 35.1 | ![]() |
CD56+_NKCells | 96.85 | ![]() |
CD71+_EarlyErythroid | 788.15 | ![]() |
CD8+_Tcells | 33.55 | ![]() |
CardiacMyocytes | 28.45 | ![]() |
Caudatenucleus | 41.5 | ![]() |
Cerebellum | 40.3 | ![]() |
CerebellumPeduncles | 36.3 | ![]() |
CiliaryGanglion | 16.2 | ![]() |
CingulateCortex | 49 | ![]() |
Colorectaladenocarcinoma | 17.3 | ![]() |
DorsalRootGanglion | 22.2 | ![]() |
FetalThyroid | 24.7 | ![]() |
Fetalbrain | 17.7 | ![]() |
Fetalliver | 173.75 | ![]() |
Fetallung | 16.3 | ![]() |
GlobusPallidus | 38.4 | ![]() |
Heart | 39.85 | ![]() |
Hypothalamus | 129.8 | ![]() |
Kidney | 75.7 | ![]() |
Leukemia_chronicMyelogenousK-562 | 15.9 | ![]() |
Leukemia_promyelocytic-HL-60 | 16.6 | ![]() |
Leukemialymphoblastic(MOLT-4) | 18.9 | ![]() |
Liver | 55.65 | ![]() |
Lung | 20.95 | ![]() |
Lymphnode | 19.35 | ![]() |
Lymphoma_burkitts(Daudi) | 25.95 | ![]() |
Lymphoma_burkitts(Raji) | 27.15 | ![]() |
MedullaOblongata | 31.5 | ![]() |
OccipitalLobe | 37.8 | ![]() |
OlfactoryBulb | 95.1 | ![]() |
Ovary | 12.7 | ![]() |
Pancreas | 16 | ![]() |
PancreaticIslet | 28.7 | ![]() |
ParietalLobe | 42.7 | ![]() |
Pituitary | 27.95 | ![]() |
Placenta | 25.15 | ![]() |
Pons | 31.15 | ![]() |
PrefrontalCortex | 72.05 | ![]() |
Prostate | 66.45 | ![]() |
Salivarygland | 27.05 | ![]() |
SkeletalMuscle | 25.5 | ![]() |
Skin | 20.5 | ![]() |
SmoothMuscle | 21.8 | ![]() |
Spinalcord | 162.5 | ![]() |
SubthalamicNucleus | 35.3 | ![]() |
SuperiorCervicalGanglion | 43.4 | ![]() |
TemporalLobe | 18.25 | ![]() |
Testis | 20 | ![]() |
TestisGermCell | 21.6 | ![]() |
TestisIntersitial | 16.25 | ![]() |
TestisLeydigCell | 19.1 | ![]() |
TestisSeminiferousTubule | 15.75 | ![]() |
Thalamus | 62.7 | ![]() |
Thymus | 23.1 | ![]() |
Thyroid | 71.15 | ![]() |
Tongue | 18.8 | ![]() |
Tonsil | 18.7 | ![]() |
Trachea | 16.35 | ![]() |
TrigeminalGanglion | 26.35 | ![]() |
Uterus | 15.7 | ![]() |
UterusCorpus | 17.4 | ![]() |
WholeBlood | 20.1 | ![]() |
Wholebrain | 88 | ![]() |
colon | 46.15 | ![]() |
pineal_day | 153.8 | ![]() |
pineal_night | 124.06 | ![]() |
retina | 161.25 | ![]() |
small_intestine | 63.2 | ![]() |
- Probe name: A_23_P324278
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.6 ± 0.46 | ![]() ![]() ![]() |
Basal Forebrain | 6.24 ± 0.34 | ![]() ![]() ![]() |
Basal Part of Pons | 6.16 ± 0.4 | ![]() ![]() ![]() |
Cerebellar Cortex | 5.65 ± 0.18 | ![]() ![]() ![]() |
Cerebellar Nuclei | 5.94 ± 0.49 | ![]() ![]() ![]() |
Claustrum | 5.66 ± 0.47 | ![]() ![]() ![]() |
Epithalamus | 6.08 ± 0.63 | ![]() ![]() ![]() |
Frontal Lobe | 5.88 ± 0.4 | ![]() ![]() ![]() |
Globus Pallidus | 7.14 ± 0.29 | ![]() ![]() ![]() |
Hypothalamus | 6.08 ± 0.43 | ![]() ![]() ![]() |
Insula | 5.58 ± 0.44 | ![]() ![]() ![]() |
Limbic Lobe | 5.77 ± 0.45 | ![]() ![]() ![]() |
Mesencephalon | 6.01 ± 0.53 | ![]() ![]() ![]() |
Myelencephalon | 5.98 ± 0.44 | ![]() ![]() ![]() |
Occipital Lobe | 5.95 ± 0.33 | ![]() ![]() ![]() |
Parietal Lobe | 5.99 ± 0.42 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.91 ± 0.46 | ![]() ![]() ![]() |
Striatum | 6.33 ± 0.4 | ![]() ![]() ![]() |
Subthalamus | 5.97 ± 0.51 | ![]() ![]() ![]() |
Temporal Lobe | 5.88 ± 0.35 | ![]() ![]() ![]() |
Thalamus | 6.12 ± 0.36 | ![]() ![]() ![]() |
White Matter | 7.3 ± 0.3 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Alad | CB | Cerebellum | 22.47 | ![]() |
19.04 | ![]() | |||
Alad | CTX | Cerebral cortex | 100 | ![]() |
50.16 | ![]() | |||
Alad | HIP | Hippocampal region | 53.81 | ![]() |
57.91 | ![]() | |||
Alad | HPF | Hippocampal formation | 61.11 | ![]() |
47.53 | ![]() | |||
Alad | HY | Hypothalamus | 100 | ![]() |
52.68 | ![]() | |||
Alad | LSX | Lateral septal complex | 100 | ![]() |
70.85 | ![]() | |||
Alad | MB | Midbrain | 52.12 | ![]() |
24.28 | ![]() | |||
Alad | MY | Medulla | 44.4 | ![]() |
22.82 | ![]() | |||
Alad | OLF | Olfactory bulb | 100 | ![]() |
64.7 | ![]() | |||
Alad | P | Pons | 51.45 | ![]() |
25.31 | ![]() | |||
Alad | PAL | Pallidum | 94.74 | ![]() |
46.94 | ![]() | |||
Alad | RHP | Retrohippocampal region | 75.83 | ![]() |
35.3 | ![]() | |||
Alad | sAMY | Striatum-like amygdalar nuclei | 100 | ![]() |
41.31 | ![]() | |||
Alad | STR | Striatum | 89.49 | ![]() |
39.49 | ![]() | |||
Alad | STRd | Striatum dorsal region | 69.53 | ![]() |
28.71 | ![]() | |||
Alad | STRv | Striatum ventral region | 100 | ![]() |
58.99 | ![]() | |||
Alad | TH | Thalamus | 88.13 | ![]() |
44.91 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
HEM2_HUMAN_149 | 10 | 149 | 158 | LAEVALAYAK | PRIDE |
HEM2_HUMAN_243 | 19 | 243 | 261 | EGADMLMVKPGMPYLDIVR | PRIDE |
HEM2_HUMAN_244 | 19 | 244 | 262 | EGADMLMVKPGMPYLDIVR | PRIDE |
HEM2_HUMAN_265 | 32 | 265 | 296 | DKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLK | PRIDE |
HEM2_HUMAN_297 | 11 | 297 | 307 | AAVLEAMTAFR | PRIDE |
HEM2_HUMAN_59 | 15 | 59 | 73 | RLEEMLRPLVEEGLR | PRIDE |
HEM2_HUMAN_90 | 19 | 90 | 108 | GSAADSEESPAIEAIHLLR | PRIDE |
HEM2_HUMAN_91 | 19 | 91 | 109 | GSAADSEESPAIEAIHLLR | PRIDE |
PAp00033788 | 10 | 209 | 218 | FASCFYGPFR | Peptide Atlas |