Annotation Detail for ALDH1A3
Basic Information Top
Gene Symbol: | ALDH1A3 ( ALDH1A6,ALDH6,RALDH3 ) |
---|---|
Gene Full Name: | aldehyde dehydrogenase 1 family, member A3 |
Band: | 15q26.3 |
Quick Links | Entrez ID:220; OMIM: 600463; Uniprot ID:AL1A3_HUMAN; ENSEMBL ID: ENSG00000184254; HGNC ID: 409 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.459538
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 0 / 70761 | 0 | |
blastocyst | 1 / 62319 | 16 | |
fetus | 6 / 564012 | 10 | |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 139 / 1939121 | 71 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 3 / 17475 | 171 | |
breast (mammary gland) tumor | 12 / 94178 | 127 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 16 / 114246 | 140 | |
esophageal tumor | 1 / 17290 | 57 | |
gastrointestinal tumor | 8 / 119369 | 67 | |
germ cell tumor | 1 / 263845 | 3 | |
glioma | 6 / 106883 | 56 | |
head and neck tumor | 6 / 136302 | 44 | |
kidney tumor | 2 / 68959 | 29 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 8 / 96359 | 83 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 4 / 97250 | 41 | |
normal | 133 / 3360307 | 39 | |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 21 / 104616 | 200 | |
primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | |
prostate cancer | 27 / 102680 | 262 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 11 / 124949 | 88 | |
soft tissue/muscle tissue tumor | 4 / 125191 | 31 | |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 3 / 13106 | 228 | |
adrenal gland | 1 / 33197 | 30 | |
ascites | 0 / 40015 | 0 | |
bladder | 3 / 29757 | 100 | |
blood | 0 / 123478 | 0 | |
bone | 4 / 71655 | 55 | |
bone marrow | 0 / 48801 | 0 | |
brain | 32 / 1100989 | 29 | |
cervix | 2 / 48171 | 41 | |
connective tissue | 4 / 149255 | 26 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 3 / 215722 | 13 | |
esophagus | 1 / 20209 | 49 | |
eye | 7 / 211054 | 33 | |
heart | 1 / 89626 | 11 | |
intestine | 20 / 234472 | 85 | |
kidney | 3 / 211777 | 14 | |
larynx | 0 / 24145 | 0 | |
liver | 10 / 207743 | 48 | |
lung | 16 / 336974 | 47 | |
lymph | 0 / 44270 | 0 | |
lymph node | 10 / 91610 | 109 | |
mammary gland | 30 / 153271 | 195 | |
mouth | 6 / 67052 | 89 | |
muscle | 5 / 107715 | 46 | |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 21 / 214812 | 97 | |
parathyroid | 1 / 20539 | 48 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 3 / 280825 | 10 | |
prostate | 54 / 189345 | 285 | |
salivary gland | 0 / 20155 | 0 | |
skin | 16 / 210574 | 75 | |
spleen | 1 / 53952 | 18 | |
stomach | 6 / 96619 | 62 | |
testis | 18 / 330442 | 54 | |
thymus | 1 / 81131 | 12 | |
thyroid | 3 / 47473 | 63 | |
tonsil | 0 / 16999 | 0 | |
trachea | 21 / 52413 | 400 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 9 / 232878 | 38 | |
vascular | 5 / 51780 | 96 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 203180_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 6.35 | |
Adipocyte | 11.7 | |
AdrenalCortex | 6.9 | |
Adrenalgland | 7.25 | |
Amygdala | 5.8 | |
Appendix | 6.45 | |
AtrioventricularNode | 4.7 | |
BDCA4+_DentriticCells | 5.65 | |
Bonemarrow | 5.9 | |
BronchialEpithelialCells | 916.55 | |
CD105+_Endothelial | 5.75 | |
CD14+_Monocytes | 5.75 | |
CD19+_BCells(neg._sel.) | 5.6 | |
CD33+_Myeloid | 6.65 | |
CD34+ | 6.45 | |
CD4+_Tcells | 5.7 | |
CD56+_NKCells | 6.2 | |
CD71+_EarlyErythroid | 5.4 | |
CD8+_Tcells | 4.95 | |
CardiacMyocytes | 16.3 | |
Caudatenucleus | 5.05 | |
Cerebellum | 4.65 | |
CerebellumPeduncles | 6.8 | |
CiliaryGanglion | 4.45 | |
CingulateCortex | 5.75 | |
Colorectaladenocarcinoma | 247.8 | |
DorsalRootGanglion | 5.5 | |
FetalThyroid | 5.3 | |
Fetalbrain | 5.2 | |
Fetalliver | 4.85 | |
Fetallung | 4.55 | |
GlobusPallidus | 4.25 | |
Heart | 7.5 | |
Hypothalamus | 6.15 | |
Kidney | 5 | |
Leukemia_chronicMyelogenousK-562 | 4.8 | |
Leukemia_promyelocytic-HL-60 | 4.75 | |
Leukemialymphoblastic(MOLT-4) | 4.35 | |
Liver | 7.85 | |
Lung | 16.9 | |
Lymphnode | 4.7 | |
Lymphoma_burkitts(Daudi) | 7.25 | |
Lymphoma_burkitts(Raji) | 7.9 | |
MedullaOblongata | 5.1 | |
OccipitalLobe | 5.05 | |
OlfactoryBulb | 11.35 | |
Ovary | 3.9 | |
Pancreas | 4.95 | |
PancreaticIslet | 6.25 | |
ParietalLobe | 6.35 | |
Pituitary | 6.6 | |
Placenta | 6.15 | |
Pons | 5.5 | |
PrefrontalCortex | 6.65 | |
Prostate | 695.8 | |
Salivarygland | 21 | |
SkeletalMuscle | 8.65 | |
Skin | 7.35 | |
SmoothMuscle | 693.15 | |
Spinalcord | 6.8 | |
SubthalamicNucleus | 5.35 | |
SuperiorCervicalGanglion | 6.95 | |
TemporalLobe | 5.35 | |
Testis | 8.3 | |
TestisGermCell | 39.1 | |
TestisIntersitial | 9.4 | |
TestisLeydigCell | 6.2 | |
TestisSeminiferousTubule | 9.5 | |
Thalamus | 5.9 | |
Thymus | 4.25 | |
Thyroid | 6.45 | |
Tongue | 5.95 | |
Tonsil | 5.6 | |
Trachea | 21.35 | |
TrigeminalGanglion | 5.7 | |
Uterus | 8.3 | |
UterusCorpus | 5.2 | |
WholeBlood | 5.75 | |
Wholebrain | 4.75 | |
colon | 5.8 | |
pineal_day | 10.48 | |
pineal_night | 13.66 | |
retina | 189.525 | |
small_intestine | 102.75 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: CUST_16042_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 4.83 ± 0.84 | |
Basal Forebrain | 5.07 ± 0.57 | |
Basal Part of Pons | 4.33 ± 0.46 | |
Cerebellar Cortex | 5.7 ± 0.54 | |
Cerebellar Nuclei | 6.07 ± 0.45 | |
Claustrum | 4.61 ± 1.33 | |
Epithalamus | 4.14 ± 0.72 | |
Frontal Lobe | 4.82 ± 0.68 | |
Globus Pallidus | 5.68 ± 0.61 | |
Hypothalamus | 4.8 ± 0.94 | |
Insula | 4.54 ± 0.58 | |
Limbic Lobe | 4.74 ± 0.83 | |
Mesencephalon | 5.17 ± 0.76 | |
Myelencephalon | 5.07 ± 0.82 | |
Occipital Lobe | 5.9 ± 0.81 | |
Parietal Lobe | 5.41 ± 0.63 | |
Pontine Tegmentum | 5.27 ± 0.75 | |
Striatum | 4.6 ± 0.74 | |
Subthalamus | 4.81 ± 0.67 | |
Temporal Lobe | 4.77 ± 0.64 | |
Thalamus | 5.35 ± 0.41 | |
White Matter | 6.55 ± 0.52 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Aldh1a3 | CB | Cerebellum | 2.41 | |
2.81 | ||||
Aldh1a3 | CTX | Cerebral cortex | 3.45 | |
1.66 | ||||
Aldh1a3 | HIP | Hippocampal region | 0.39 | |
0.38 | ||||
Aldh1a3 | HPF | Hippocampal formation | 0.51 | |
0.37 | ||||
Aldh1a3 | HY | Hypothalamus | 0.71 | |
0.37 | ||||
Aldh1a3 | LSX | Lateral septal complex | 0.59 | |
0.33 | ||||
Aldh1a3 | MB | Midbrain | 0.77 | |
0.48 | ||||
Aldh1a3 | MY | Medulla | 3.23 | |
1.85 | ||||
Aldh1a3 | OLF | Olfactory bulb | 4.8 | |
2.65 | ||||
Aldh1a3 | P | Pons | 2.47 | |
1.59 | ||||
Aldh1a3 | PAL | Pallidum | 0.8 | |
0.73 | ||||
Aldh1a3 | RHP | Retrohippocampal region | 0.75 | |
0.32 | ||||
Aldh1a3 | sAMY | Striatum-like amygdalar nuclei | 0.59 | |
0.23 | ||||
Aldh1a3 | STR | Striatum | 0.42 | |
0.28 | ||||
Aldh1a3 | STRd | Striatum dorsal region | 0.46 | |
0.38 | ||||
Aldh1a3 | STRv | Striatum ventral region | 0.27 | |
0.11 | ||||
Aldh1a3 | TH | Thalamus | 0.43 | |
0.33 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
AL1A3_HUMAN_111 | 28 | 111 | 138 | ATLAALETMDTGKPFLHAFFIDLEGCIR | PRIDE |
AL1A3_HUMAN_142 | 12 | 142 | 153 | YFAGWADKIQGK | PRIDE |
AL1A3_HUMAN_154 | 13 | 154 | 166 | TIPTDDNVVCFTR | PRIDE |
AL1A3_HUMAN_167 | 23 | 167 | 189 | HEPIGVCGAITPWNFPLLMLVWK | PRIDE |
AL1A3_HUMAN_190 | 31 | 190 | 220 | LAPALCCGNTMVLKPAEQTPLTALYLGSLIK | PRIDE |
AL1A3_HUMAN_2 | 14 | 2 | 15 | ATANGAVENGQPDR | PRIDE |
AL1A3_HUMAN_221 | 31 | 221 | 251 | EAGFPPGVVNIVPGFGPTVGAAISSHPQINK | PRIDE |
AL1A3_HUMAN_252 | 11 | 252 | 262 | IAFTGSTEVGK | PRIDE |
AL1A3_HUMAN_319 | 13 | 319 | 331 | VFVEEQVYSEFVR | PRIDE |
AL1A3_HUMAN_319 | 14 | 319 | 332 | VFVEEQVYSEFVRR | PRIDE |
AL1A3_HUMAN_339 | 21 | 339 | 359 | KRPVGDPFDVKTEQGPQIDQK | PRIDE |
AL1A3_HUMAN_389 | 17 | 389 | 405 | GLFIKPTVFSEVTDNMR | PRIDE |
AL1A3_HUMAN_406 | 15 | 406 | 420 | IAKEEIFGPVQPILK | PRIDE |
AL1A3_HUMAN_431 | 15 | 431 | 445 | ANSTDYGLTAAVFTK | PRIDE |
AL1A3_HUMAN_487 | 14 | 487 | 500 | ELGEYALAEYTEVK | PRIDE |
AL1A3_HUMAN_73 | 11 | 73 | 83 | AVEAAQVAFQR | PRIDE |
AL1A3_HUMAN_98 | 11 | 98 | 108 | LLHQLADLVER | PRIDE |
PAp00069986 | 11 | 253 | 263 | IAFTGSTEVGK | Peptide Atlas |