Annotation Detail for CNKSR2
Basic Information Top
| Gene Symbol: | CNKSR2 ( CNK2,KIAA0902,KSR2,MAGUIN ) |
|---|---|
| Gene Full Name: | connector enhancer of kinase suppressor of Ras 2 |
| Band: | Xp22.12 |
| Quick Links | Entrez ID:22866; OMIM: 300724; Uniprot ID:CNKR2_HUMAN; ENSEMBL ID: ENSG00000149970; HGNC ID: 19701 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.555917
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 1 / 70761 | 14 | |
| blastocyst | 0 / 62319 | 0 | |
| fetus | 18 / 564012 | 31 | |
| neonate | 0 / 31097 | 0 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 0 / 55556 | 0 | |
| adult | 30 / 1939121 | 15 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 0 / 94178 | 0 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 0 / 82823 | 0 | |
| colorectal tumor | 0 / 114246 | 0 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 0 / 119369 | 0 | |
| germ cell tumor | 10 / 263845 | 37 | |
| glioma | 2 / 106883 | 18 | |
| head and neck tumor | 0 / 136302 | 0 | |
| kidney tumor | 3 / 68959 | 43 | |
| leukemia | 1 / 95842 | 10 | |
| liver tumor | 0 / 96359 | 0 | |
| lung tumor | 0 / 103127 | 0 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 0 / 97250 | 0 | |
| normal | 116 / 3360307 | 34 | |
| ovarian tumor | 0 / 76682 | 0 | |
| pancreatic tumor | 0 / 104616 | 0 | |
| primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | |
| prostate cancer | 1 / 102680 | 9 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
| uterine tumor | 0 / 90257 | 0 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 0 / 29757 | 0 | |
| blood | 1 / 123478 | 8 | |
| bone | 2 / 71655 | 27 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 114 / 1100989 | 103 | |
| cervix | 0 / 48171 | 0 | |
| connective tissue | 0 / 149255 | 0 | |
| ear | 1 / 16212 | 61 | |
| embryonic tissue | 1 / 215722 | 4 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 2 / 211054 | 9 | |
| heart | 0 / 89626 | 0 | |
| intestine | 0 / 234472 | 0 | |
| kidney | 3 / 211777 | 14 | |
| larynx | 0 / 24145 | 0 | |
| liver | 0 / 207743 | 0 | |
| lung | 5 / 336974 | 14 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 2 / 91610 | 21 | |
| mammary gland | 1 / 153271 | 6 | |
| mouth | 0 / 67052 | 0 | |
| muscle | 0 / 107715 | 0 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 0 / 102051 | 0 | |
| pancreas | 0 / 214812 | 0 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 0 / 280825 | 0 | |
| prostate | 4 / 189345 | 21 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 0 / 210574 | 0 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 0 / 96619 | 0 | |
| testis | 6 / 330442 | 18 | |
| thymus | 0 / 81131 | 0 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 0 / 232878 | 0 | |
| vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 206731_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 8.45 | |
| Adipocyte | 8.1 | |
| AdrenalCortex | 9.2 | |
| Adrenalgland | 7.25 | |
| Amygdala | 25.2 | |
| Appendix | 11.65 | |
| AtrioventricularNode | 8.15 | |
| BDCA4+_DentriticCells | 7.9 | |
| Bonemarrow | 8.6 | |
| BronchialEpithelialCells | 7.6 | |
| CD105+_Endothelial | 8.1 | |
| CD14+_Monocytes | 8.95 | |
| CD19+_BCells(neg._sel.) | 8.35 | |
| CD33+_Myeloid | 10.25 | |
| CD34+ | 10 | |
| CD4+_Tcells | 7.95 | |
| CD56+_NKCells | 9.45 | |
| CD71+_EarlyErythroid | 7.95 | |
| CD8+_Tcells | 7.35 | |
| CardiacMyocytes | 13.3 | |
| Caudatenucleus | 16.2 | |
| Cerebellum | 7.35 | |
| CerebellumPeduncles | 15.95 | |
| CiliaryGanglion | 8.15 | |
| CingulateCortex | 11.75 | |
| Colorectaladenocarcinoma | 8.4 | |
| DorsalRootGanglion | 8.45 | |
| FetalThyroid | 8.25 | |
| Fetalbrain | 14.9 | |
| Fetalliver | 7.6 | |
| Fetallung | 6.1 | |
| GlobusPallidus | 9.1 | |
| Heart | 16.55 | |
| Hypothalamus | 8.4 | |
| Kidney | 7 | |
| Leukemia_chronicMyelogenousK-562 | 7.35 | |
| Leukemia_promyelocytic-HL-60 | 7.4 | |
| Leukemialymphoblastic(MOLT-4) | 6.5 | |
| Liver | 11.95 | |
| Lung | 8.9 | |
| Lymphnode | 6.75 | |
| Lymphoma_burkitts(Daudi) | 10.7 | |
| Lymphoma_burkitts(Raji) | 12.6 | |
| MedullaOblongata | 12 | |
| OccipitalLobe | 11.6 | |
| OlfactoryBulb | 6.45 | |
| Ovary | 6.4 | |
| Pancreas | 6.8 | |
| PancreaticIslet | 8.85 | |
| ParietalLobe | 10.5 | |
| Pituitary | 9.8 | |
| Placenta | 8.3 | |
| Pons | 13.95 | |
| PrefrontalCortex | 29.3 | |
| Prostate | 9.6 | |
| Salivarygland | 6.8 | |
| SkeletalMuscle | 11.55 | |
| Skin | 8.4 | |
| SmoothMuscle | 9.45 | |
| Spinalcord | 8.8 | |
| SubthalamicNucleus | 8.7 | |
| SuperiorCervicalGanglion | 12.3 | |
| TemporalLobe | 15.45 | |
| Testis | 7.2 | |
| TestisGermCell | 6.5 | |
| TestisIntersitial | 7.1 | |
| TestisLeydigCell | 9.05 | |
| TestisSeminiferousTubule | 7.35 | |
| Thalamus | 8.6 | |
| Thymus | 6.55 | |
| Thyroid | 10.15 | |
| Tongue | 8.9 | |
| Tonsil | 8.2 | |
| Trachea | 6.85 | |
| TrigeminalGanglion | 10.8 | |
| Uterus | 6.7 | |
| UterusCorpus | 7.65 | |
| WholeBlood | 8.95 | |
| Wholebrain | 11.3 | |
| colon | 8.25 | |
| pineal_day | 10.2 | |
| pineal_night | 10.22 | |
| retina | 10.225 | |
| small_intestine | 8.1 |
- Probe name: CUST_976_PI416573500
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 6.7 ± 0.5 | |
| Basal Forebrain | 5.42 ± 0.51 | |
| Basal Part of Pons | 5.37 ± 0.47 | |
| Cerebellar Cortex | 6.52 ± 0.19 | |
| Cerebellar Nuclei | 5.03 ± 0.57 | |
| Claustrum | 6.38 ± 0.55 | |
| Epithalamus | 5.22 ± 0.39 | |
| Frontal Lobe | 5.86 ± 0.55 | |
| Globus Pallidus | 4.11 ± 0.66 | |
| Hypothalamus | 5.41 ± 0.61 | |
| Insula | 6.16 ± 0.49 | |
| Limbic Lobe | 6.58 ± 0.59 | |
| Mesencephalon | 5.82 ± 0.64 | |
| Myelencephalon | 5.91 ± 0.56 | |
| Occipital Lobe | 6.88 ± 0.5 | |
| Parietal Lobe | 6.14 ± 0.55 | |
| Pontine Tegmentum | 6.09 ± 0.65 | |
| Striatum | 6.27 ± 0.46 | |
| Subthalamus | 6.53 ± 1.04 | |
| Temporal Lobe | 6.12 ± 0.43 | |
| Thalamus | 5.64 ± 0.44 | |
| White Matter | 3.14 ± 0.31 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Cnksr2 | CB | Cerebellum | 6.14 | |
| 7.05 | ||||
| Cnksr2 | CTX | Cerebral cortex | 11.84 | |
| 8.73 | ||||
| Cnksr2 | HIP | Hippocampal region | 21.4 | |
| 28.82 | ||||
| Cnksr2 | HPF | Hippocampal formation | 15.37 | |
| 18.49 | ||||
| Cnksr2 | HY | Hypothalamus | 0.19 | |
| 0.21 | ||||
| Cnksr2 | LSX | Lateral septal complex | 0 | |
| 0 | ||||
| Cnksr2 | MB | Midbrain | 0.41 | |
| 0.69 | ||||
| Cnksr2 | MY | Medulla | 0.84 | |
| 1.06 | ||||
| Cnksr2 | OLF | Olfactory bulb | 8.45 | |
| 6.46 | ||||
| Cnksr2 | P | Pons | 0.37 | |
| 0.55 | ||||
| Cnksr2 | PAL | Pallidum | 0.22 | |
| 0.23 | ||||
| Cnksr2 | RHP | Retrohippocampal region | 5.05 | |
| 4.06 | ||||
| Cnksr2 | sAMY | Striatum-like amygdalar nuclei | 0.56 | |
| 0.51 | ||||
| Cnksr2 | STR | Striatum | 1.96 | |
| 1.53 | ||||
| Cnksr2 | STRd | Striatum dorsal region | 1.59 | |
| 1.3 | ||||
| Cnksr2 | STRv | Striatum ventral region | 5.49 | |
| 3.76 | ||||
| Cnksr2 | TH | Thalamus | 0.61 | |
| 1.11 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| CNKR2_HUMAN_137 | 8 | 137 | 144 | SLLAWLDR | PRIDE |
| CNKR2_HUMAN_145 | 13 | 145 | 157 | SPFAAVTDYSVTR | PRIDE |
| CNKR2_HUMAN_277 | 7 | 277 | 283 | NLVNALR | PRIDE |
| CNKR2_HUMAN_284 | 11 | 284 | 294 | EDPSGVILTLK | PRIDE |
| CNKR2_HUMAN_39 | 8 | 39 | 46 | ISGDQLLR | PRIDE |
| CNKR2_HUMAN_60 | 27 | 60 | 86 | IGHQELILEAVDLLCALNYGLETENLK | PRIDE |
| CNKR2_HUMAN_767 | 39 | 767 | 805 | SWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAISPEHR | PRIDE |
| CNKR2_HUMAN_807 | 8 | 807 | 814 | QSTLPTQK | PRIDE |
| CNKR2_HUMAN_832 | 12 | 832 | 843 | MQVLNGNGGKPR | PRIDE |
| CNKR2_HUMAN_844 | 6 | 844 | 849 | SFTLPR | PRIDE |
| CNKR2_HUMAN_905 | 10 | 905 | 914 | LGDSLQDLYR | PRIDE |
| CNKR2_HUMAN_915 | 14 | 915 | 928 | ALEQASLSPLGEHR | PRIDE |



