Annotation Detail for DIP2C
Basic Information Top
Gene Symbol: | DIP2C ( FLJ34444,FLJ44075,KIAA0934 ) |
---|---|
Gene Full Name: | DIP2 disco-interacting protein 2 homolog C (Drosophila) |
Band: | 10p15.3 |
Quick Links | Entrez ID:22982; OMIM: 611380; Uniprot ID:DIP2C_HUMAN; ENSEMBL ID: ENSG00000151240; HGNC ID: 29150 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.432397
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 5 / 70761 | 70 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 52 / 564012 | 92 | |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 2 / 55556 | 35 | |
adult | 93 / 1939121 | 47 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 3 / 82823 | 36 | |
colorectal tumor | 3 / 114246 | 26 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 4 / 119369 | 33 | |
germ cell tumor | 6 / 263845 | 22 | |
glioma | 5 / 106883 | 46 | |
head and neck tumor | 1 / 136302 | 7 | |
kidney tumor | 7 / 68959 | 101 | |
leukemia | 1 / 95842 | 10 | |
liver tumor | 5 / 96359 | 51 | |
lung tumor | 1 / 103127 | 9 | |
lymphoma | 1 / 71755 | 13 | |
non-neoplasia | 2 / 97250 | 20 | |
normal | 192 / 3360307 | 57 | |
ovarian tumor | 1 / 76682 | 13 | |
pancreatic tumor | 3 / 104616 | 28 | |
primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | |
prostate cancer | 5 / 102680 | 48 | |
retinoblastoma | 1 / 46356 | 21 | |
skin tumor | 9 / 124949 | 72 | |
soft tissue/muscle tissue tumor | 3 / 125191 | 23 | |
uterine tumor | 1 / 90257 | 11 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 1 / 33197 | 30 | |
ascites | 1 / 40015 | 24 | |
bladder | 0 / 29757 | 0 | |
blood | 0 / 123478 | 0 | |
bone | 4 / 71655 | 55 | |
bone marrow | 2 / 48801 | 40 | |
brain | 61 / 1100989 | 55 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 2 / 149255 | 13 | |
ear | 8 / 16212 | 493 | |
embryonic tissue | 7 / 215722 | 32 | |
esophagus | 0 / 20209 | 0 | |
eye | 16 / 211054 | 75 | |
heart | 1 / 89626 | 11 | |
intestine | 8 / 234472 | 34 | |
kidney | 26 / 211777 | 122 | |
larynx | 0 / 24145 | 0 | |
liver | 7 / 207743 | 33 | |
lung | 16 / 336974 | 47 | |
lymph | 0 / 44270 | 0 | |
lymph node | 1 / 91610 | 10 | |
mammary gland | 6 / 153271 | 39 | |
mouth | 2 / 67052 | 29 | |
muscle | 6 / 107715 | 55 | |
nerve | 0 / 15768 | 0 | |
ovary | 1 / 102051 | 9 | |
pancreas | 3 / 214812 | 13 | |
parathyroid | 1 / 20539 | 48 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 1 / 16585 | 60 | |
placenta | 5 / 280825 | 17 | |
prostate | 8 / 189345 | 42 | |
salivary gland | 0 / 20155 | 0 | |
skin | 28 / 210574 | 132 | |
spleen | 0 / 53952 | 0 | |
stomach | 2 / 96619 | 20 | |
testis | 24 / 330442 | 72 | |
thymus | 2 / 81131 | 24 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 1 / 52413 | 19 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 4 / 232878 | 17 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 212503_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 5.15 | |
Adipocyte | 47.7 | |
AdrenalCortex | 26.5 | |
Adrenalgland | 12.2 | |
Amygdala | 143 | |
Appendix | 15.65 | |
AtrioventricularNode | 19.9 | |
BDCA4+_DentriticCells | 5.1 | |
Bonemarrow | 4.75 | |
BronchialEpithelialCells | 6.35 | |
CD105+_Endothelial | 5.95 | |
CD14+_Monocytes | 6.9 | |
CD19+_BCells(neg._sel.) | 7.95 | |
CD33+_Myeloid | 6.15 | |
CD34+ | 7.1 | |
CD4+_Tcells | 7.95 | |
CD56+_NKCells | 6.75 | |
CD71+_EarlyErythroid | 4.65 | |
CD8+_Tcells | 6.85 | |
CardiacMyocytes | 13.15 | |
Caudatenucleus | 77.1 | |
Cerebellum | 75 | |
CerebellumPeduncles | 67.9 | |
CiliaryGanglion | 8.9 | |
CingulateCortex | 54.1 | |
Colorectaladenocarcinoma | 7 | |
DorsalRootGanglion | 33.25 | |
FetalThyroid | 11.25 | |
Fetalbrain | 250.4 | |
Fetalliver | 6.5 | |
Fetallung | 17.8 | |
GlobusPallidus | 26.95 | |
Heart | 12.9 | |
Hypothalamus | 86 | |
Kidney | 41.05 | |
Leukemia_chronicMyelogenousK-562 | 4.35 | |
Leukemia_promyelocytic-HL-60 | 4 | |
Leukemialymphoblastic(MOLT-4) | 5.25 | |
Liver | 12.1 | |
Lung | 12.45 | |
Lymphnode | 7.6 | |
Lymphoma_burkitts(Daudi) | 7.2 | |
Lymphoma_burkitts(Raji) | 12.75 | |
MedullaOblongata | 79.85 | |
OccipitalLobe | 72.65 | |
OlfactoryBulb | 45.75 | |
Ovary | 11.6 | |
Pancreas | 6.45 | |
PancreaticIslet | 64.1 | |
ParietalLobe | 60.75 | |
Pituitary | 12.95 | |
Placenta | 24 | |
Pons | 17.8 | |
PrefrontalCortex | 207 | |
Prostate | 41.1 | |
Salivarygland | 8.1 | |
SkeletalMuscle | 18.55 | |
Skin | 11.9 | |
SmoothMuscle | 11.5 | |
Spinalcord | 51.05 | |
SubthalamicNucleus | 29.85 | |
SuperiorCervicalGanglion | 20.05 | |
TemporalLobe | 39.5 | |
Testis | 17.75 | |
TestisGermCell | 22.7 | |
TestisIntersitial | 9.1 | |
TestisLeydigCell | 7.75 | |
TestisSeminiferousTubule | 10.05 | |
Thalamus | 52.45 | |
Thymus | 5.3 | |
Thyroid | 23.75 | |
Tongue | 13.1 | |
Tonsil | 6.45 | |
Trachea | 8.9 | |
TrigeminalGanglion | 11.45 | |
Uterus | 94 | |
UterusCorpus | 31.65 | |
WholeBlood | 7.15 | |
Wholebrain | 112.05 | |
colon | 30.15 | |
pineal_day | 56.58 | |
pineal_night | 64.34 | |
retina | 96.075 | |
small_intestine | 48.55 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: CUST_7539_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 4.75 ± 0.45 | |
Basal Forebrain | 4.68 ± 0.38 | |
Basal Part of Pons | 5.05 ± 0.48 | |
Cerebellar Cortex | 4.89 ± 0.38 | |
Cerebellar Nuclei | 4.61 ± 0.53 | |
Claustrum | 4.88 ± 0.57 | |
Epithalamus | 4.58 ± 0.51 | |
Frontal Lobe | 4.71 ± 0.41 | |
Globus Pallidus | 4.69 ± 0.52 | |
Hypothalamus | 4.34 ± 0.74 | |
Insula | 4.71 ± 0.46 | |
Limbic Lobe | 5.02 ± 0.42 | |
Mesencephalon | 4.74 ± 0.44 | |
Myelencephalon | 4.79 ± 0.44 | |
Occipital Lobe | 5.14 ± 0.47 | |
Parietal Lobe | 4.85 ± 0.37 | |
Pontine Tegmentum | 4.84 ± 0.45 | |
Striatum | 5.03 ± 0.47 | |
Subthalamus | 4.54 ± 0.07 | |
Temporal Lobe | 4.78 ± 0.39 | |
Thalamus | 4.81 ± 0.41 | |
White Matter | 6.04 ± 0.31 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Dip2c | CB | Cerebellum | 11.98 | |
13.24 | ||||
Dip2c | CTX | Cerebral cortex | 15.75 | |
11.35 | ||||
Dip2c | HIP | Hippocampal region | 19.33 | |
20.98 | ||||
Dip2c | HPF | Hippocampal formation | 25.05 | |
23.23 | ||||
Dip2c | HY | Hypothalamus | 5.93 | |
4.38 | ||||
Dip2c | LSX | Lateral septal complex | 7.83 | |
5.08 | ||||
Dip2c | MB | Midbrain | 9.46 | |
9.73 | ||||
Dip2c | MY | Medulla | 18.21 | |
20.72 | ||||
Dip2c | OLF | Olfactory bulb | 17.61 | |
12.73 | ||||
Dip2c | P | Pons | 16.31 | |
18.53 | ||||
Dip2c | PAL | Pallidum | 5.5 | |
4.69 | ||||
Dip2c | RHP | Retrohippocampal region | 34.93 | |
26.84 | ||||
Dip2c | sAMY | Striatum-like amygdalar nuclei | 5.6 | |
3.58 | ||||
Dip2c | STR | Striatum | 6.66 | |
4.48 | ||||
Dip2c | STRd | Striatum dorsal region | 6.67 | |
4.65 | ||||
Dip2c | STRv | Striatum ventral region | 7.45 | |
4.71 | ||||
Dip2c | TH | Thalamus | 4.3 | |
3.56 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
DIP2C_HUMAN_1014 | 8 | 1014 | 1021 | IAVMLMER | PRIDE |
DIP2C_HUMAN_1074 | 7 | 1074 | 1080 | MIVEVSR | PRIDE |
DIP2C_HUMAN_1166 | 9 | 1166 | 1174 | LQCELYPSR | PRIDE |
DIP2C_HUMAN_1285 | 7 | 1285 | 1291 | DLGLHPR | PRIDE |
DIP2C_HUMAN_1292 | 9 | 1292 | 1300 | AVSTSFGCR | PRIDE |
DIP2C_HUMAN_1336 | 13 | 1336 | 1348 | GSPHSLPLMESGK | PRIDE |
DIP2C_HUMAN_1403 | 12 | 1403 | 1414 | LSFGDTQTIWAR | PRIDE |
DIP2C_HUMAN_1423 | 11 | 1423 | 1433 | RTELTDANGER | PRIDE |
DIP2C_HUMAN_327 | 7 | 327 | 333 | WGTISPK | PRIDE |
DIP2C_HUMAN_362 | 8 | 362 | 369 | VAYSILHK | PRIDE |
DIP2C_HUMAN_64 | 10 | 64 | 73 | APVTPSSASR | PRIDE |
DIP2C_HUMAN_645 | 19 | 645 | 663 | QEVICPCASSPEALTVAIR | PRIDE |
DIP2C_HUMAN_696 | 31 | 696 | 726 | LSVLTVQDVGLVMPGAIMCSVKPDGVPQLCR | PRIDE |
DIP2C_HUMAN_827 | 13 | 827 | 839 | IAVFSVTVLHDER | PRIDE |
DIP2C_HUMAN_888 | 12 | 888 | 899 | TPLGGIHLSETK | PRIDE |
DIP2C_HUMAN_930 | 18 | 930 | 947 | QPEIGPASVMVGNLVSGK | PRIDE |
DIP2C_HUMAN_996 | 14 | 996 | 1009 | GAIANSLTCVQLHK | PRIDE |
PAp00028021 | 11 | 1262 | 1272 | TCVVVAEERPR | Peptide Atlas |