Annotation Detail for UBR4


Gene Symbol: | UBR4 ( FLJ41863,KIAA0462,KIAA1307,RBAF600,ZUBR1,p600 ) |
---|---|
Gene Full Name: | ubiquitin protein ligase E3 component n-recognin 4 |
Band: | 1p36.13 |
Quick Links | Entrez ID:23352; OMIM: 609890; Uniprot ID:UBR4_HUMAN; ENSEMBL ID: ENSG00000127481; HGNC ID: 30313 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.649405
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 7 / 70761 | 98 | ![]() |
blastocyst | 18 / 62319 | 288 | ![]() |
fetus | 74 / 564012 | 131 | ![]() |
neonate | 10 / 31097 | 321 | ![]() |
infant | 3 / 23620 | 127 | ![]() |
juvenile | 9 / 55556 | 161 | ![]() |
adult | 430 / 1939121 | 221 | ![]() |
embryoid body | 1 / 70761 | 14 | ![]() |
blastocyst | 0 / 62319 | 0 | |
fetus | 2 / 564012 | 3 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 2 / 1939121 | 1 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 3 / 12794 | 234 | ![]() |
bladder carcinoma | 2 / 17475 | 114 | ![]() |
breast (mammary gland) tumor | 22 / 94178 | 233 | ![]() |
cervical tumor | 3 / 34366 | 87 | ![]() |
chondrosarcoma | 14 / 82823 | 169 | ![]() |
colorectal tumor | 36 / 114246 | 315 | ![]() |
esophageal tumor | 4 / 17290 | 231 | ![]() |
gastrointestinal tumor | 40 / 119369 | 335 | ![]() |
germ cell tumor | 34 / 263845 | 128 | ![]() |
glioma | 6 / 106883 | 56 | ![]() |
head and neck tumor | 41 / 136302 | 300 | ![]() |
kidney tumor | 7 / 68959 | 101 | ![]() |
leukemia | 19 / 95842 | 198 | ![]() |
liver tumor | 16 / 96359 | 166 | ![]() |
lung tumor | 34 / 103127 | 329 | ![]() |
lymphoma | 12 / 71755 | 167 | ![]() |
non-neoplasia | 3 / 97250 | 30 | ![]() |
normal | 472 / 3360307 | 140 | ![]() |
ovarian tumor | 9 / 76682 | 117 | ![]() |
pancreatic tumor | 16 / 104616 | 152 | ![]() |
primitive neuroectodermal tumor of the CNS | 4 / 125680 | 31 | ![]() |
prostate cancer | 6 / 102680 | 58 | ![]() |
retinoblastoma | 2 / 46356 | 43 | ![]() |
skin tumor | 16 / 124949 | 128 | ![]() |
soft tissue/muscle tissue tumor | 15 / 125191 | 119 | ![]() |
uterine tumor | 18 / 90257 | 199 | ![]() |
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 0 / 114246 | 0 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 0 / 263845 | 0 | |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 0 / 97250 | 0 | |
normal | 5 / 3360307 | 1 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 1 / 124949 | 8 | ![]() |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 5 / 33197 | 150 | ![]() |
ascites | 10 / 40015 | 249 | ![]() |
bladder | 2 / 29757 | 67 | ![]() |
blood | 20 / 123478 | 161 | ![]() |
bone | 23 / 71655 | 320 | ![]() |
bone marrow | 3 / 48801 | 61 | ![]() |
brain | 133 / 1100989 | 120 | ![]() |
cervix | 4 / 48171 | 83 | ![]() |
connective tissue | 17 / 149255 | 113 | ![]() |
ear | 2 / 16212 | 123 | ![]() |
embryonic tissue | 37 / 215722 | 171 | ![]() |
esophagus | 4 / 20209 | 197 | ![]() |
eye | 21 / 211054 | 99 | ![]() |
heart | 4 / 89626 | 44 | ![]() |
intestine | 52 / 234472 | 221 | ![]() |
kidney | 34 / 211777 | 160 | ![]() |
larynx | 17 / 24145 | 704 | ![]() |
liver | 26 / 207743 | 125 | ![]() |
lung | 66 / 336974 | 195 | ![]() |
lymph | 9 / 44270 | 203 | ![]() |
lymph node | 5 / 91610 | 54 | ![]() |
mammary gland | 37 / 153271 | 241 | ![]() |
mouth | 12 / 67052 | 178 | ![]() |
muscle | 20 / 107715 | 185 | ![]() |
nerve | 4 / 15768 | 253 | ![]() |
ovary | 11 / 102051 | 107 | ![]() |
pancreas | 21 / 214812 | 97 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 9 / 41328 | 217 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 63 / 280825 | 224 | ![]() |
prostate | 17 / 189345 | 89 | ![]() |
salivary gland | 1 / 20155 | 49 | ![]() |
skin | 27 / 210574 | 128 | ![]() |
spleen | 7 / 53952 | 129 | ![]() |
stomach | 31 / 96619 | 320 | ![]() |
testis | 77 / 330442 | 233 | ![]() |
thymus | 16 / 81131 | 197 | ![]() |
thyroid | 6 / 47473 | 126 | ![]() |
tonsil | 1 / 16999 | 58 | ![]() |
trachea | 3 / 52413 | 57 | ![]() |
umbilical cord | 9 / 13680 | 657 | ![]() |
uterus | 31 / 232878 | 133 | ![]() |
vascular | 2 / 51780 | 38 | ![]() |
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 0 / 123478 | 0 | |
bone | 0 / 71655 | 0 | |
bone marrow | 0 / 48801 | 0 | |
brain | 0 / 1100989 | 0 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 0 / 149255 | 0 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 3 / 215722 | 13 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 0 / 211054 | 0 | |
heart | 0 / 89626 | 0 | |
intestine | 0 / 234472 | 0 | |
kidney | 0 / 211777 | 0 | |
larynx | 0 / 24145 | 0 | |
liver | 0 / 207743 | 0 | |
lung | 0 / 336974 | 0 | |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 0 / 153271 | 0 | |
mouth | 0 / 67052 | 0 | |
muscle | 0 / 107715 | 0 | |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 1 / 280825 | 3 | ![]() |
prostate | 0 / 189345 | 0 | |
salivary gland | 0 / 20155 | 0 | |
skin | 1 / 210574 | 4 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 0 / 96619 | 0 | |
testis | 0 / 330442 | 0 | |
thymus | 0 / 81131 | 0 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 1 / 232878 | 4 | ![]() |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 211950_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 164.15 | ![]() |
Adipocyte | 31.8 | ![]() |
AdrenalCortex | 23.8 | ![]() |
Adrenalgland | 15.2 | ![]() |
Amygdala | 34.85 | ![]() |
Appendix | 7.7 | ![]() |
AtrioventricularNode | 4.25 | ![]() |
BDCA4+_DentriticCells | 102.55 | ![]() |
Bonemarrow | 42.9 | ![]() |
BronchialEpithelialCells | 55.6 | ![]() |
CD105+_Endothelial | 138.2 | ![]() |
CD14+_Monocytes | 195.25 | ![]() |
CD19+_BCells(neg._sel.) | 47.6 | ![]() |
CD33+_Myeloid | 363.35 | ![]() |
CD34+ | 200.65 | ![]() |
CD4+_Tcells | 215.8 | ![]() |
CD56+_NKCells | 86.9 | ![]() |
CD71+_EarlyErythroid | 201.5 | ![]() |
CD8+_Tcells | 196.15 | ![]() |
CardiacMyocytes | 10.15 | ![]() |
Caudatenucleus | 12.55 | ![]() |
Cerebellum | 22.7 | ![]() |
CerebellumPeduncles | 17.35 | ![]() |
CiliaryGanglion | 8.35 | ![]() |
CingulateCortex | 25.35 | ![]() |
Colorectaladenocarcinoma | 59.45 | ![]() |
DorsalRootGanglion | 4.3 | ![]() |
FetalThyroid | 32.15 | ![]() |
Fetalbrain | 62.35 | ![]() |
Fetalliver | 24.2 | ![]() |
Fetallung | 43.05 | ![]() |
GlobusPallidus | 9.95 | ![]() |
Heart | 12.95 | ![]() |
Hypothalamus | 61 | ![]() |
Kidney | 36.45 | ![]() |
Leukemia_chronicMyelogenousK-562 | 162.6 | ![]() |
Leukemia_promyelocytic-HL-60 | 112.25 | ![]() |
Leukemialymphoblastic(MOLT-4) | 57.3 | ![]() |
Liver | 27.5 | ![]() |
Lung | 49.55 | ![]() |
Lymphnode | 36.3 | ![]() |
Lymphoma_burkitts(Daudi) | 45.9 | ![]() |
Lymphoma_burkitts(Raji) | 171.85 | ![]() |
MedullaOblongata | 23.05 | ![]() |
OccipitalLobe | 20.3 | ![]() |
OlfactoryBulb | 24.45 | ![]() |
Ovary | 5.3 | ![]() |
Pancreas | 26.05 | ![]() |
PancreaticIslet | 23.3 | ![]() |
ParietalLobe | 16.05 | ![]() |
Pituitary | 18.9 | ![]() |
Placenta | 97.35 | ![]() |
Pons | 9.4 | ![]() |
PrefrontalCortex | 119.5 | ![]() |
Prostate | 52.25 | ![]() |
Salivarygland | 10.8 | ![]() |
SkeletalMuscle | 15.9 | ![]() |
Skin | 91 | ![]() |
SmoothMuscle | 34.95 | ![]() |
Spinalcord | 35.1 | ![]() |
SubthalamicNucleus | 11.55 | ![]() |
SuperiorCervicalGanglion | 6.3 | ![]() |
TemporalLobe | 12 | ![]() |
Testis | 167.4 | ![]() |
TestisGermCell | 319.3 | ![]() |
TestisIntersitial | 119.6 | ![]() |
TestisLeydigCell | 79.2 | ![]() |
TestisSeminiferousTubule | 185.3 | ![]() |
Thalamus | 42.55 | ![]() |
Thymus | 53.8 | ![]() |
Thyroid | 30.35 | ![]() |
Tongue | 13.6 | ![]() |
Tonsil | 34.8 | ![]() |
Trachea | 10.95 | ![]() |
TrigeminalGanglion | 5.55 | ![]() |
Uterus | 44.4 | ![]() |
UterusCorpus | 10.55 | ![]() |
WholeBlood | 51.05 | ![]() |
Wholebrain | 25.45 | ![]() |
colon | 15.55 | ![]() |
pineal_day | 139.08 | ![]() |
pineal_night | 105.88 | ![]() |
retina | 143 | ![]() |
small_intestine | 16.1 | ![]() |
- Probe name: CUST_2279_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 7.03 ± 0.59 | ![]() ![]() ![]() |
Basal Forebrain | 7.38 ± 0.29 | ![]() ![]() ![]() |
Basal Part of Pons | 7.69 ± 0.33 | ![]() ![]() ![]() |
Cerebellar Cortex | 7.67 ± 0.37 | ![]() ![]() ![]() |
Cerebellar Nuclei | 7.14 ± 0.4 | ![]() ![]() ![]() |
Claustrum | 7.01 ± 0.47 | ![]() ![]() ![]() |
Epithalamus | 7.4 ± 0.39 | ![]() ![]() ![]() |
Frontal Lobe | 7.61 ± 0.37 | ![]() ![]() ![]() |
Globus Pallidus | 6.97 ± 0.15 | ![]() ![]() ![]() |
Hypothalamus | 7.62 ± 0.36 | ![]() ![]() ![]() |
Insula | 7.7 ± 0.28 | ![]() ![]() ![]() |
Limbic Lobe | 7.35 ± 0.41 | ![]() ![]() ![]() |
Mesencephalon | 7.4 ± 0.38 | ![]() ![]() ![]() |
Myelencephalon | 7.41 ± 0.45 | ![]() ![]() ![]() |
Occipital Lobe | 7.08 ± 0.43 | ![]() ![]() ![]() |
Parietal Lobe | 7.38 ± 0.41 | ![]() ![]() ![]() |
Pontine Tegmentum | 7.34 ± 0.43 | ![]() ![]() ![]() |
Striatum | 7.01 ± 0.34 | ![]() ![]() ![]() |
Subthalamus | 7.33 ± 0.27 | ![]() ![]() ![]() |
Temporal Lobe | 7.56 ± 0.38 | ![]() ![]() ![]() |
Thalamus | 7.52 ± 0.38 | ![]() ![]() ![]() |
White Matter | 7.2 ± 0.31 | ![]() ![]() ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00005677 | 37 | 1249 | 1285 | NAFANDTIPSESYISAVQAAHLGTLCSQSLPLAASLK | Peptide Atlas |
UBR4_HUMAN_4608 | 11 | 4608 | 4618 | SNPSVLQGLLR | PRIDE |