Annotation Detail for ABCA6
Basic Information Top
| Gene Symbol: | ABCA6 ( EST155051,FLJ43498 ) |
|---|---|
| Gene Full Name: | ATP-binding cassette, sub-family A (ABC1), member 6 |
| Band: | 17q24.2-q24.3 |
| Quick Links | Entrez ID:23460; OMIM: 612504; Uniprot ID:ABCA6_HUMAN; ENSEMBL ID: ENSG00000154262; HGNC ID: 36 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.709514
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 0 / 70761 | 0 | |
| blastocyst | 0 / 62319 | 0 | |
| fetus | 8 / 564012 | 14 | |
| neonate | 0 / 31097 | 0 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 19 / 1939121 | 9 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 1 / 17475 | 57 | |
| breast (mammary gland) tumor | 1 / 94178 | 10 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 1 / 82823 | 12 | |
| colorectal tumor | 0 / 114246 | 0 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 1 / 119369 | 8 | |
| germ cell tumor | 1 / 263845 | 3 | |
| glioma | 0 / 106883 | 0 | |
| head and neck tumor | 1 / 136302 | 7 | |
| kidney tumor | 0 / 68959 | 0 | |
| leukemia | 1 / 95842 | 10 | |
| liver tumor | 2 / 96359 | 20 | |
| lung tumor | 1 / 103127 | 9 | |
| lymphoma | 3 / 71755 | 41 | |
| non-neoplasia | 1 / 97250 | 10 | |
| normal | 53 / 3360307 | 15 | |
| ovarian tumor | 0 / 76682 | 0 | |
| pancreatic tumor | 1 / 104616 | 9 | |
| primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
| prostate cancer | 0 / 102680 | 0 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
| uterine tumor | 1 / 90257 | 11 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 0 / 29757 | 0 | |
| blood | 2 / 123478 | 16 | |
| bone | 0 / 71655 | 0 | |
| bone marrow | 2 / 48801 | 40 | |
| brain | 4 / 1100989 | 3 | |
| cervix | 0 / 48171 | 0 | |
| connective tissue | 1 / 149255 | 6 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 0 / 215722 | 0 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 2 / 211054 | 9 | |
| heart | 0 / 89626 | 0 | |
| intestine | 1 / 234472 | 4 | |
| kidney | 3 / 211777 | 14 | |
| larynx | 0 / 24145 | 0 | |
| liver | 4 / 207743 | 19 | |
| lung | 5 / 336974 | 14 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 4 / 91610 | 43 | |
| mammary gland | 1 / 153271 | 6 | |
| mouth | 0 / 67052 | 0 | |
| muscle | 1 / 107715 | 9 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 1 / 102051 | 9 | |
| pancreas | 2 / 214812 | 9 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 4 / 280825 | 14 | |
| prostate | 0 / 189345 | 0 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 0 / 210574 | 0 | |
| spleen | 2 / 53952 | 37 | |
| stomach | 1 / 96619 | 10 | |
| testis | 2 / 330442 | 6 | |
| thymus | 1 / 81131 | 12 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 2 / 52413 | 38 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 6 / 232878 | 25 | |
| vascular | 3 / 51780 | 57 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 217504_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 7.3 | |
| Adipocyte | 6.65 | |
| AdrenalCortex | 7.85 | |
| Adrenalgland | 6 | |
| Amygdala | 6.6 | |
| Appendix | 11.75 | |
| AtrioventricularNode | 9.95 | |
| BDCA4+_DentriticCells | 6.9 | |
| Bonemarrow | 7.25 | |
| BronchialEpithelialCells | 6.45 | |
| CD105+_Endothelial | 6.9 | |
| CD14+_Monocytes | 7.05 | |
| CD19+_BCells(neg._sel.) | 6.95 | |
| CD33+_Myeloid | 8.15 | |
| CD34+ | 8.1 | |
| CD4+_Tcells | 7.15 | |
| CD56+_NKCells | 7.8 | |
| CD71+_EarlyErythroid | 6.4 | |
| CD8+_Tcells | 6.2 | |
| CardiacMyocytes | 12.95 | |
| Caudatenucleus | 6 | |
| Cerebellum | 5.5 | |
| CerebellumPeduncles | 7.8 | |
| CiliaryGanglion | 7.2 | |
| CingulateCortex | 7.05 | |
| Colorectaladenocarcinoma | 6.6 | |
| DorsalRootGanglion | 9.55 | |
| FetalThyroid | 6.6 | |
| Fetalbrain | 6.45 | |
| Fetalliver | 7.8 | |
| Fetallung | 5.8 | |
| GlobusPallidus | 5.4 | |
| Heart | 9.1 | |
| Hypothalamus | 6.9 | |
| Kidney | 6 | |
| Leukemia_chronicMyelogenousK-562 | 5.95 | |
| Leukemia_promyelocytic-HL-60 | 5.9 | |
| Leukemialymphoblastic(MOLT-4) | 5.25 | |
| Liver | 9.25 | |
| Lung | 7.2 | |
| Lymphnode | 5.6 | |
| Lymphoma_burkitts(Daudi) | 8.8 | |
| Lymphoma_burkitts(Raji) | 9.6 | |
| MedullaOblongata | 6.15 | |
| OccipitalLobe | 6 | |
| OlfactoryBulb | 11.3 | |
| Ovary | 5.6 | |
| Pancreas | 5.6 | |
| PancreaticIslet | 7.35 | |
| ParietalLobe | 7.5 | |
| Pituitary | 7.85 | |
| Placenta | 6.7 | |
| Pons | 6.6 | |
| PrefrontalCortex | 7.95 | |
| Prostate | 7.6 | |
| Salivarygland | 7.05 | |
| SkeletalMuscle | 12.45 | |
| Skin | 6.15 | |
| SmoothMuscle | 10.9 | |
| Spinalcord | 7.4 | |
| SubthalamicNucleus | 6.4 | |
| SuperiorCervicalGanglion | 12.95 | |
| TemporalLobe | 6.3 | |
| Testis | 5.7 | |
| TestisGermCell | 5.45 | |
| TestisIntersitial | 5.85 | |
| TestisLeydigCell | 6.95 | |
| TestisSeminiferousTubule | 7.65 | |
| Thalamus | 6.9 | |
| Thymus | 4.95 | |
| Thyroid | 8 | |
| Tongue | 7.3 | |
| Tonsil | 6.7 | |
| Trachea | 5.6 | |
| TrigeminalGanglion | 14.35 | |
| Uterus | 5.3 | |
| UterusCorpus | 7.25 | |
| WholeBlood | 7.15 | |
| Wholebrain | 5.45 | |
| colon | 6.65 | |
| pineal_day | 8.12 | |
| pineal_night | 8.16 | |
| retina | 8.2 | |
| small_intestine | 6.3 |
- Probe name: CUST_15724_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 3.88 ± 0.49 | |
| Basal Forebrain | 3.47 ± 0.55 | |
| Basal Part of Pons | 4.37 ± 0.32 | |
| Cerebellar Cortex | 4.02 ± 0.5 | |
| Cerebellar Nuclei | 4.26 ± 0.5 | |
| Claustrum | 3.74 ± 0.49 | |
| Epithalamus | 3.68 ± 0.68 | |
| Frontal Lobe | 3.89 ± 0.54 | |
| Globus Pallidus | 4.34 ± 0.8 | |
| Hypothalamus | 3.57 ± 0.37 | |
| Insula | 3.82 ± 0.59 | |
| Limbic Lobe | 3.94 ± 0.61 | |
| Mesencephalon | 4.16 ± 0.63 | |
| Myelencephalon | 3.98 ± 0.63 | |
| Occipital Lobe | 4.61 ± 0.48 | |
| Parietal Lobe | 4.14 ± 0.49 | |
| Pontine Tegmentum | 3.98 ± 0.61 | |
| Striatum | 3.55 ± 0.68 | |
| Subthalamus | 4.31 ± 0.47 | |
| Temporal Lobe | 3.96 ± 0.54 | |
| Thalamus | 4.43 ± 0.54 | |
| White Matter | 3.76 ± 0.82 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Abca6 | CB | Cerebellum | 10.75 | |
| 12.25 | ||||
| Abca6 | CTX | Cerebral cortex | 8.3 | |
| 6.18 | ||||
| Abca6 | HIP | Hippocampal region | 5.79 | |
| 5.4 | ||||
| Abca6 | HPF | Hippocampal formation | 8.86 | |
| 7.68 | ||||
| Abca6 | HY | Hypothalamus | 1.76 | |
| 2.51 | ||||
| Abca6 | LSX | Lateral septal complex | 0.24 | |
| 0.24 | ||||
| Abca6 | MB | Midbrain | 2.87 | |
| 3.5 | ||||
| Abca6 | MY | Medulla | 9.16 | |
| 10.4 | ||||
| Abca6 | OLF | Olfactory bulb | 15.98 | |
| 13.46 | ||||
| Abca6 | P | Pons | 7.6 | |
| 9.45 | ||||
| Abca6 | PAL | Pallidum | 1.24 | |
| 1.2 | ||||
| Abca6 | RHP | Retrohippocampal region | 15.89 | |
| 12.27 | ||||
| Abca6 | sAMY | Striatum-like amygdalar nuclei | 1.03 | |
| 0.61 | ||||
| Abca6 | STR | Striatum | 2.84 | |
| 1.97 | ||||
| Abca6 | STRd | Striatum dorsal region | 3.26 | |
| 2.35 | ||||
| Abca6 | STRv | Striatum ventral region | 3.05 | |
| 1.8 | ||||
| Abca6 | TH | Thalamus | 5.26 | |
| 5.59 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| ABCA6_HUMAN_66 | 34 | 66 | 99 | VDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLK | PRIDE |



