Annotation Detail for AMACR


Gene Symbol: | AMACR ( CBAS4,RACE,RM ) |
---|---|
Gene Full Name: | alpha-methylacyl-CoA racemase |
Band: | 5p13.2 |
Quick Links | Entrez ID:23600; OMIM: 604489; Uniprot ID:AMACR_HUMAN; ENSEMBL ID: ENSG00000082196,ENSG00000242110; HGNC ID: 451 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.508343
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 0 / 70761 | 0 | |
blastocyst | 5 / 62319 | 80 | ![]() |
fetus | 14 / 564012 | 24 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 1 / 55556 | 17 | ![]() |
adult | 111 / 1939121 | 57 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 3 / 94178 | 31 | ![]() |
cervical tumor | 1 / 34366 | 29 | ![]() |
chondrosarcoma | 1 / 82823 | 12 | ![]() |
colorectal tumor | 3 / 114246 | 26 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 9 / 263845 | 34 | ![]() |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 7 / 136302 | 51 | ![]() |
kidney tumor | 10 / 68959 | 145 | ![]() |
leukemia | 6 / 95842 | 62 | ![]() |
liver tumor | 6 / 96359 | 62 | ![]() |
lung tumor | 1 / 103127 | 9 | ![]() |
lymphoma | 2 / 71755 | 27 | ![]() |
non-neoplasia | 4 / 97250 | 41 | ![]() |
normal | 105 / 3360307 | 31 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 6 / 104616 | 57 | ![]() |
primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | ![]() |
prostate cancer | 64 / 102680 | 623 | ![]() |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 2 / 124949 | 16 | ![]() |
soft tissue/muscle tissue tumor | 2 / 125191 | 15 | ![]() |
uterine tumor | 4 / 90257 | 44 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 3 / 29757 | 100 | ![]() |
blood | 5 / 123478 | 40 | ![]() |
bone | 2 / 71655 | 27 | ![]() |
bone marrow | 1 / 48801 | 20 | ![]() |
brain | 36 / 1100989 | 32 | ![]() |
cervix | 5 / 48171 | 103 | ![]() |
connective tissue | 5 / 149255 | 33 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 8 / 215722 | 37 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 6 / 211054 | 28 | ![]() |
heart | 2 / 89626 | 22 | ![]() |
intestine | 11 / 234472 | 46 | ![]() |
kidney | 51 / 211777 | 240 | ![]() |
larynx | 1 / 24145 | 41 | ![]() |
liver | 12 / 207743 | 57 | ![]() |
lung | 12 / 336974 | 35 | ![]() |
lymph | 1 / 44270 | 22 | ![]() |
lymph node | 1 / 91610 | 10 | ![]() |
mammary gland | 3 / 153271 | 19 | ![]() |
mouth | 1 / 67052 | 14 | ![]() |
muscle | 4 / 107715 | 37 | ![]() |
nerve | 1 / 15768 | 63 | ![]() |
ovary | 0 / 102051 | 0 | |
pancreas | 6 / 214812 | 27 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 4 / 41328 | 96 | ![]() |
pituitary gland | 0 / 16585 | 0 | |
placenta | 8 / 280825 | 28 | ![]() |
prostate | 65 / 189345 | 343 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 3 / 210574 | 14 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 5 / 96619 | 51 | ![]() |
testis | 17 / 330442 | 51 | ![]() |
thymus | 2 / 81131 | 24 | ![]() |
thyroid | 1 / 47473 | 21 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 3 / 52413 | 57 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 4 / 232878 | 17 | ![]() |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 209425_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 5.95 | ![]() |
Adipocyte | 4.75 | ![]() |
AdrenalCortex | 5.45 | ![]() |
Adrenalgland | 4.15 | ![]() |
Amygdala | 5 | ![]() |
Appendix | 5.2 | ![]() |
AtrioventricularNode | 4.05 | ![]() |
BDCA4+_DentriticCells | 5.3 | ![]() |
Bonemarrow | 5 | ![]() |
BronchialEpithelialCells | 4.8 | ![]() |
CD105+_Endothelial | 4.85 | ![]() |
CD14+_Monocytes | 5.25 | ![]() |
CD19+_BCells(neg._sel.) | 5.2 | ![]() |
CD33+_Myeloid | 6.05 | ![]() |
CD34+ | 6.1 | ![]() |
CD4+_Tcells | 5.15 | ![]() |
CD56+_NKCells | 5.6 | ![]() |
CD71+_EarlyErythroid | 4.5 | ![]() |
CD8+_Tcells | 4.55 | ![]() |
CardiacMyocytes | 6.6 | ![]() |
Caudatenucleus | 4.4 | ![]() |
Cerebellum | 3.95 | ![]() |
CerebellumPeduncles | 6.1 | ![]() |
CiliaryGanglion | 6.25 | ![]() |
CingulateCortex | 4.95 | ![]() |
Colorectaladenocarcinoma | 4.85 | ![]() |
DorsalRootGanglion | 6 | ![]() |
FetalThyroid | 4.7 | ![]() |
Fetalbrain | 4.75 | ![]() |
Fetalliver | 4.2 | ![]() |
Fetallung | 3.9 | ![]() |
GlobusPallidus | 3.65 | ![]() |
Heart | 6.75 | ![]() |
Hypothalamus | 5.2 | ![]() |
Kidney | 4.45 | ![]() |
Leukemia_chronicMyelogenousK-562 | 4.35 | ![]() |
Leukemia_promyelocytic-HL-60 | 4.25 | ![]() |
Leukemialymphoblastic(MOLT-4) | 3.8 | ![]() |
Liver | 6.85 | ![]() |
Lung | 5.25 | ![]() |
Lymphnode | 4.15 | ![]() |
Lymphoma_burkitts(Daudi) | 6.3 | ![]() |
Lymphoma_burkitts(Raji) | 7.1 | ![]() |
MedullaOblongata | 4.35 | ![]() |
OccipitalLobe | 4.35 | ![]() |
OlfactoryBulb | 3.85 | ![]() |
Ovary | 3.35 | ![]() |
Pancreas | 3.9 | ![]() |
PancreaticIslet | 5.2 | ![]() |
ParietalLobe | 5.25 | ![]() |
Pituitary | 5.6 | ![]() |
Placenta | 4.9 | ![]() |
Pons | 4.7 | ![]() |
PrefrontalCortex | 5.95 | ![]() |
Prostate | 5.6 | ![]() |
Salivarygland | 4 | ![]() |
SkeletalMuscle | 6.05 | ![]() |
Skin | 4.15 | ![]() |
SmoothMuscle | 5.35 | ![]() |
Spinalcord | 5.15 | ![]() |
SubthalamicNucleus | 4.75 | ![]() |
SuperiorCervicalGanglion | 5.85 | ![]() |
TemporalLobe | 4.45 | ![]() |
Testis | 4.15 | ![]() |
TestisGermCell | 3.9 | ![]() |
TestisIntersitial | 4.1 | ![]() |
TestisLeydigCell | 4.85 | ![]() |
TestisSeminiferousTubule | 4.1 | ![]() |
Thalamus | 4.95 | ![]() |
Thymus | 3.75 | ![]() |
Thyroid | 5.95 | ![]() |
Tongue | 5.2 | ![]() |
Tonsil | 4.7 | ![]() |
Trachea | 4 | ![]() |
TrigeminalGanglion | 5.25 | ![]() |
Uterus | 3.85 | ![]() |
UterusCorpus | 4.5 | ![]() |
WholeBlood | 5.35 | ![]() |
Wholebrain | 3.9 | ![]() |
colon | 4.9 | ![]() |
pineal_day | 5.96 | ![]() |
pineal_night | 5.94 | ![]() |
retina | 5.825 | ![]() |
small_intestine | 4.7 | ![]() |
- Probe name: CUST_16935_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.66 ± 0.41 | ![]() ![]() ![]() |
Basal Forebrain | 5.68 ± 0.36 | ![]() ![]() ![]() |
Basal Part of Pons | 5.55 ± 0.41 | ![]() ![]() ![]() |
Cerebellar Cortex | 5.59 ± 0.36 | ![]() ![]() ![]() |
Cerebellar Nuclei | 5.76 ± 0.52 | ![]() ![]() ![]() |
Claustrum | 6.04 ± 0.58 | ![]() ![]() ![]() |
Epithalamus | 5.59 ± 0.36 | ![]() ![]() ![]() |
Frontal Lobe | 5.49 ± 0.39 | ![]() ![]() ![]() |
Globus Pallidus | 5.52 ± 0.54 | ![]() ![]() ![]() |
Hypothalamus | 5.74 ± 0.36 | ![]() ![]() ![]() |
Insula | 5.41 ± 0.37 | ![]() ![]() ![]() |
Limbic Lobe | 5.46 ± 0.48 | ![]() ![]() ![]() |
Mesencephalon | 5.54 ± 0.55 | ![]() ![]() ![]() |
Myelencephalon | 5.5 ± 0.43 | ![]() ![]() ![]() |
Occipital Lobe | 5.59 ± 0.43 | ![]() ![]() ![]() |
Parietal Lobe | 5.64 ± 0.42 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.71 ± 0.38 | ![]() ![]() ![]() |
Striatum | 5.14 ± 0.37 | ![]() ![]() ![]() |
Subthalamus | 6.01 ± 0.28 | ![]() ![]() ![]() |
Temporal Lobe | 5.65 ± 0.37 | ![]() ![]() ![]() |
Thalamus | 5.61 ± 0.46 | ![]() ![]() ![]() |
White Matter | 4.73 ± 0.29 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Amacr | CB | Cerebellum | 0 | ![]() |
0 | ![]() | |||
Amacr | CTX | Cerebral cortex | 0 | ![]() |
0 | ![]() | |||
Amacr | HIP | Hippocampal region | 0 | ![]() |
0 | ![]() | |||
Amacr | HPF | Hippocampal formation | 0 | ![]() |
0 | ![]() | |||
Amacr | HY | Hypothalamus | 0 | ![]() |
0 | ![]() | |||
Amacr | LSX | Lateral septal complex | 0 | ![]() |
0 | ![]() | |||
Amacr | MB | Midbrain | 0 | ![]() |
0 | ![]() | |||
Amacr | MY | Medulla | 0 | ![]() |
0 | ![]() | |||
Amacr | OLF | Olfactory bulb | 0 | ![]() |
0 | ![]() | |||
Amacr | P | Pons | 0 | ![]() |
0 | ![]() | |||
Amacr | PAL | Pallidum | 0 | ![]() |
0 | ![]() | |||
Amacr | RHP | Retrohippocampal region | 0 | ![]() |
0 | ![]() | |||
Amacr | sAMY | Striatum-like amygdalar nuclei | 0 | ![]() |
0 | ![]() | |||
Amacr | STR | Striatum | 0 | ![]() |
0 | ![]() | |||
Amacr | STRd | Striatum dorsal region | 0 | ![]() |
0 | ![]() | |||
Amacr | STRv | Striatum ventral region | 0 | ![]() |
0 | ![]() | |||
Amacr | TH | Thalamus | 0 | ![]() |
0 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00095318 | 30 | 281 | 310 | AEWCQIFDGTDACVTPVLTFEEVVHHDHNK | Peptide Atlas |