Annotation Detail for GAGE2C
Basic Information Top
| Gene Symbol: | GAGE2C ( CT4.2,GAGE2,GAGE2A,GAGE2B,MGC120097,MGC96883,MGC96930,MGC96942 ) |
|---|---|
| Gene Full Name: | G antigen 2C |
| Band: | Xp11.23 not on reference assembly |
| Quick Links | Entrez ID:2574; OMIM: 300595; Uniprot ID:GAG2B_HUMAN; ENSEMBL ID: ENSG00000236249; HGNC ID: 31958 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 208155_x_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 7.8 | |
| Adipocyte | 5.05 | |
| AdrenalCortex | 5.65 | |
| Adrenalgland | 4.3 | |
| Amygdala | 5.35 | |
| Appendix | 6.85 | |
| AtrioventricularNode | 4.3 | |
| BDCA4+_DentriticCells | 5.25 | |
| Bonemarrow | 5 | |
| BronchialEpithelialCells | 5 | |
| CD105+_Endothelial | 5.25 | |
| CD14+_Monocytes | 5.5 | |
| CD19+_BCells(neg._sel.) | 5.55 | |
| CD33+_Myeloid | 6.7 | |
| CD34+ | 6.7 | |
| CD4+_Tcells | 5.75 | |
| CD56+_NKCells | 6.25 | |
| CD71+_EarlyErythroid | 4.75 | |
| CD8+_Tcells | 5.1 | |
| CardiacMyocytes | 6.2 | |
| Caudatenucleus | 4.6 | |
| Cerebellum | 4.15 | |
| CerebellumPeduncles | 5.85 | |
| CiliaryGanglion | 4.5 | |
| CingulateCortex | 5.2 | |
| Colorectaladenocarcinoma | 5.15 | |
| DorsalRootGanglion | 4.2 | |
| FetalThyroid | 5 | |
| Fetalbrain | 5 | |
| Fetalliver | 4.4 | |
| Fetallung | 4.15 | |
| GlobusPallidus | 3.75 | |
| Heart | 6.35 | |
| Hypothalamus | 5.35 | |
| Kidney | 4.05 | |
| Leukemia_chronicMyelogenousK-562 | 490.25 | |
| Leukemia_promyelocytic-HL-60 | 4.55 | |
| Leukemialymphoblastic(MOLT-4) | 4.15 | |
| Liver | 6.85 | |
| Lung | 5.65 | |
| Lymphnode | 4.5 | |
| Lymphoma_burkitts(Daudi) | 6.5 | |
| Lymphoma_burkitts(Raji) | 7.4 | |
| MedullaOblongata | 4.75 | |
| OccipitalLobe | 4.55 | |
| OlfactoryBulb | 4 | |
| Ovary | 3.45 | |
| Pancreas | 4.2 | |
| PancreaticIslet | 5.5 | |
| ParietalLobe | 5.45 | |
| Pituitary | 6 | |
| Placenta | 5.05 | |
| Pons | 4.85 | |
| PrefrontalCortex | 6.15 | |
| Prostate | 5.8 | |
| Salivarygland | 4.15 | |
| SkeletalMuscle | 6.35 | |
| Skin | 4.5 | |
| SmoothMuscle | 5.65 | |
| Spinalcord | 5.55 | |
| SubthalamicNucleus | 4.7 | |
| SuperiorCervicalGanglion | 6.75 | |
| TemporalLobe | 4.7 | |
| Testis | 335.8 | |
| TestisGermCell | 153.1 | |
| TestisIntersitial | 245.75 | |
| TestisLeydigCell | 167.95 | |
| TestisSeminiferousTubule | 330.4 | |
| Thalamus | 5.2 | |
| Thymus | 4.05 | |
| Thyroid | 6.25 | |
| Tongue | 5.05 | |
| Tonsil | 5 | |
| Trachea | 4.3 | |
| TrigeminalGanglion | 5.5 | |
| Uterus | 4.15 | |
| UterusCorpus | 4.75 | |
| WholeBlood | 5.7 | |
| Wholebrain | 4.1 | |
| colon | 5.1 | |
| pineal_day | 6.46 | |
| pineal_night | 6.3 | |
| retina | 6.275 | |
| small_intestine | 4.95 |
- Probe name: CUST_5476_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 1.97 ± 1.02 | |
| Basal Forebrain | 1.58 ± 0.27 | |
| Basal Part of Pons | 1.2 ± 0.35 | |
| Cerebellar Cortex | 1.35 ± 0.76 | |
| Cerebellar Nuclei | 1.84 ± 0.73 | |
| Claustrum | 2.43 ± 0.81 | |
| Epithalamus | 1.26 ± 0.64 | |
| Frontal Lobe | 1.41 ± 0.71 | |
| Globus Pallidus | 2.06 ± 0.26 | |
| Hypothalamus | 1.61 ± 0.59 | |
| Insula | 1.46 ± 0.63 | |
| Limbic Lobe | 1.55 ± 0.65 | |
| Mesencephalon | 1.7 ± 0.73 | |
| Myelencephalon | 1.61 ± 0.69 | |
| Occipital Lobe | 1.62 ± 0.66 | |
| Parietal Lobe | 1.6 ± 0.83 | |
| Pontine Tegmentum | 1.67 ± 0.77 | |
| Striatum | 1.8 ± 0.55 | |
| Subthalamus | 1.7 ± 0.6 | |
| Temporal Lobe | 1.46 ± 0.65 | |
| Thalamus | 1.56 ± 0.65 | |
| White Matter | 1.82 ± 0.18 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00081989 | 34 | 16 | 49 | YVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQR | Peptide Atlas |



Unigene EST