Annotation Detail for INTS7
Basic Information Top
| Gene Symbol: | INTS7 ( C1orf73,DKFZp434B168,INT7 ) |
|---|---|
| Gene Full Name: | integrator complex subunit 7 |
| Band: | 1q32.3 |
| Quick Links | Entrez ID:25896; OMIM: 611350; Uniprot ID:INT7_HUMAN; ENSEMBL ID: ENSG00000143493; HGNC ID: 24484 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.369285
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 6 / 70761 | 84 | |
| blastocyst | 1 / 62319 | 16 | |
| fetus | 63 / 564012 | 111 | |
| neonate | 3 / 31097 | 96 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 85 / 1939121 | 43 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 2 / 17475 | 114 | |
| breast (mammary gland) tumor | 18 / 94178 | 191 | |
| cervical tumor | 2 / 34366 | 58 | |
| chondrosarcoma | 0 / 82823 | 0 | |
| colorectal tumor | 2 / 114246 | 17 | |
| esophageal tumor | 4 / 17290 | 231 | |
| gastrointestinal tumor | 5 / 119369 | 41 | |
| germ cell tumor | 38 / 263845 | 144 | |
| glioma | 1 / 106883 | 9 | |
| head and neck tumor | 18 / 136302 | 132 | |
| kidney tumor | 1 / 68959 | 14 | |
| leukemia | 3 / 95842 | 31 | |
| liver tumor | 1 / 96359 | 10 | |
| lung tumor | 7 / 103127 | 67 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 2 / 97250 | 20 | |
| normal | 173 / 3360307 | 51 | |
| ovarian tumor | 0 / 76682 | 0 | |
| pancreatic tumor | 4 / 104616 | 38 | |
| primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | |
| prostate cancer | 3 / 102680 | 29 | |
| retinoblastoma | 1 / 46356 | 21 | |
| skin tumor | 5 / 124949 | 40 | |
| soft tissue/muscle tissue tumor | 13 / 125191 | 103 | |
| uterine tumor | 1 / 90257 | 11 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 2 / 13106 | 152 | |
| adrenal gland | 1 / 33197 | 30 | |
| ascites | 4 / 40015 | 99 | |
| bladder | 3 / 29757 | 100 | |
| blood | 7 / 123478 | 56 | |
| bone | 0 / 71655 | 0 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 73 / 1100989 | 66 | |
| cervix | 4 / 48171 | 83 | |
| connective tissue | 8 / 149255 | 53 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 12 / 215722 | 55 | |
| esophagus | 4 / 20209 | 197 | |
| eye | 2 / 211054 | 9 | |
| heart | 6 / 89626 | 66 | |
| intestine | 4 / 234472 | 17 | |
| kidney | 6 / 211777 | 28 | |
| larynx | 1 / 24145 | 41 | |
| liver | 3 / 207743 | 14 | |
| lung | 15 / 336974 | 44 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 10 / 91610 | 109 | |
| mammary gland | 18 / 153271 | 117 | |
| mouth | 20 / 67052 | 298 | |
| muscle | 3 / 107715 | 27 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 0 / 102051 | 0 | |
| pancreas | 4 / 214812 | 18 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 2 / 16585 | 120 | |
| placenta | 6 / 280825 | 21 | |
| prostate | 4 / 189345 | 21 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 10 / 210574 | 47 | |
| spleen | 1 / 53952 | 18 | |
| stomach | 1 / 96619 | 10 | |
| testis | 106 / 330442 | 320 | |
| thymus | 18 / 81131 | 221 | |
| thyroid | 1 / 47473 | 21 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 5 / 52413 | 95 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 10 / 232878 | 42 | |
| vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 222250_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 37 | |
| Adipocyte | 7.45 | |
| AdrenalCortex | 10.15 | |
| Adrenalgland | 6.95 | |
| Amygdala | 7.8 | |
| Appendix | 11.2 | |
| AtrioventricularNode | 7.15 | |
| BDCA4+_DentriticCells | 7.6 | |
| Bonemarrow | 7.9 | |
| BronchialEpithelialCells | 7.3 | |
| CD105+_Endothelial | 10.85 | |
| CD14+_Monocytes | 8.25 | |
| CD19+_BCells(neg._sel.) | 7.4 | |
| CD33+_Myeloid | 9.15 | |
| CD34+ | 13.85 | |
| CD4+_Tcells | 7.6 | |
| CD56+_NKCells | 8.55 | |
| CD71+_EarlyErythroid | 13.45 | |
| CD8+_Tcells | 6.7 | |
| CardiacMyocytes | 11.25 | |
| Caudatenucleus | 6.9 | |
| Cerebellum | 6.25 | |
| CerebellumPeduncles | 10.1 | |
| CiliaryGanglion | 6.35 | |
| CingulateCortex | 8.25 | |
| Colorectaladenocarcinoma | 7.7 | |
| DorsalRootGanglion | 6.5 | |
| FetalThyroid | 7.75 | |
| Fetalbrain | 7.5 | |
| Fetalliver | 7.7 | |
| Fetallung | 5.65 | |
| GlobusPallidus | 6.1 | |
| Heart | 10.25 | |
| Hypothalamus | 7.65 | |
| Kidney | 6.9 | |
| Leukemia_chronicMyelogenousK-562 | 8.55 | |
| Leukemia_promyelocytic-HL-60 | 6.85 | |
| Leukemialymphoblastic(MOLT-4) | 15.65 | |
| Liver | 11.4 | |
| Lung | 7.85 | |
| Lymphnode | 6.35 | |
| Lymphoma_burkitts(Daudi) | 22.25 | |
| Lymphoma_burkitts(Raji) | 10.95 | |
| MedullaOblongata | 6.95 | |
| OccipitalLobe | 6.75 | |
| OlfactoryBulb | 5.95 | |
| Ovary | 5.6 | |
| Pancreas | 6.25 | |
| PancreaticIslet | 8.4 | |
| ParietalLobe | 9 | |
| Pituitary | 9.45 | |
| Placenta | 7.45 | |
| Pons | 7.8 | |
| PrefrontalCortex | 8.85 | |
| Prostate | 8.75 | |
| Salivarygland | 6.35 | |
| SkeletalMuscle | 22.25 | |
| Skin | 6.65 | |
| SmoothMuscle | 9.25 | |
| Spinalcord | 8.05 | |
| SubthalamicNucleus | 7.4 | |
| SuperiorCervicalGanglion | 12.3 | |
| TemporalLobe | 7.45 | |
| Testis | 12.7 | |
| TestisGermCell | 26.95 | |
| TestisIntersitial | 24.55 | |
| TestisLeydigCell | 12.25 | |
| TestisSeminiferousTubule | 10.05 | |
| Thalamus | 7.9 | |
| Thymus | 6.35 | |
| Thyroid | 9.3 | |
| Tongue | 8.3 | |
| Tonsil | 7.95 | |
| Trachea | 6.4 | |
| TrigeminalGanglion | 10.25 | |
| Uterus | 5.9 | |
| UterusCorpus | 12.8 | |
| WholeBlood | 8.4 | |
| Wholebrain | 5.85 | |
| colon | 7.6 | |
| pineal_day | 9.32 | |
| pineal_night | 9.02 | |
| retina | 8.625 | |
| small_intestine | 6.3 |
- Probe name: CUST_7370_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 5.93 ± 0.4 | |
| Basal Forebrain | 5.96 ± 0.23 | |
| Basal Part of Pons | 5.92 ± 0.29 | |
| Cerebellar Cortex | 5.71 ± 0.33 | |
| Cerebellar Nuclei | 6.02 ± 0.36 | |
| Claustrum | 5.96 ± 0.52 | |
| Epithalamus | 5.64 ± 0.44 | |
| Frontal Lobe | 5.84 ± 0.35 | |
| Globus Pallidus | 5.93 ± 0.44 | |
| Hypothalamus | 5.78 ± 0.39 | |
| Insula | 5.77 ± 0.44 | |
| Limbic Lobe | 5.76 ± 0.3 | |
| Mesencephalon | 5.82 ± 0.4 | |
| Myelencephalon | 5.81 ± 0.37 | |
| Occipital Lobe | 5.71 ± 0.36 | |
| Parietal Lobe | 5.79 ± 0.28 | |
| Pontine Tegmentum | 5.77 ± 0.35 | |
| Striatum | 6.15 ± 0.25 | |
| Subthalamus | 6.05 ± 0.12 | |
| Temporal Lobe | 5.78 ± 0.28 | |
| Thalamus | 5.84 ± 0.33 | |
| White Matter | 6.49 ± 0.12 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Ints7 | CB | Cerebellum | 22.14 | |
| 28.03 | ||||
| Ints7 | CTX | Cerebral cortex | 100 | |
| 81.74 | ||||
| Ints7 | HIP | Hippocampal region | 40.41 | |
| 39.84 | ||||
| Ints7 | HPF | Hippocampal formation | 46.73 | |
| 41.83 | ||||
| Ints7 | HY | Hypothalamus | 7.99 | |
| 6.3 | ||||
| Ints7 | LSX | Lateral septal complex | 10.91 | |
| 9.05 | ||||
| Ints7 | MB | Midbrain | 8.1 | |
| 7.48 | ||||
| Ints7 | MY | Medulla | 15.99 | |
| 17.53 | ||||
| Ints7 | OLF | Olfactory bulb | 73.4 | |
| 60.73 | ||||
| Ints7 | P | Pons | 13.83 | |
| 16.8 | ||||
| Ints7 | PAL | Pallidum | 7.64 | |
| 6.33 | ||||
| Ints7 | RHP | Retrohippocampal region | 60.43 | |
| 46.81 | ||||
| Ints7 | sAMY | Striatum-like amygdalar nuclei | 35.86 | |
| 26.44 | ||||
| Ints7 | STR | Striatum | 45.51 | |
| 31.68 | ||||
| Ints7 | STRd | Striatum dorsal region | 53.08 | |
| 35.84 | ||||
| Ints7 | STRv | Striatum ventral region | 51.69 | |
| 36.94 | ||||
| Ints7 | TH | Thalamus | 4.64 | |
| 3.83 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| INT7_HUMAN_2 | 33 | 2 | 34 | ASNSTKSFLADAGYGEQELDANSALMELDKGLR | PRIDE |
| PAp00069931 | 15 | 326 | 340 | HYFSIVPGNVSSSPR | Peptide Atlas |



