Annotation Detail for SIPA1L1
Basic Information Top
Gene Symbol: | SIPA1L1 ( DKFZp686G1344,E6TP1,KIAA0440 ) |
---|---|
Gene Full Name: | signal-induced proliferation-associated 1 like 1 |
Band: | 14q24.1 |
Quick Links | Entrez ID:26037; OMIM: NA; Uniprot ID:SI1L1_HUMAN; ENSEMBL ID: ENSG00000197555; HGNC ID: 20284 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.654657
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 5 / 70761 | 70 | |
blastocyst | 3 / 62319 | 48 | |
fetus | 38 / 564012 | 67 | |
neonate | 4 / 31097 | 128 | |
infant | 0 / 23620 | 0 | |
juvenile | 2 / 55556 | 35 | |
adult | 112 / 1939121 | 57 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 1 / 17475 | 57 | |
breast (mammary gland) tumor | 5 / 94178 | 53 | |
cervical tumor | 2 / 34366 | 58 | |
chondrosarcoma | 10 / 82823 | 120 | |
colorectal tumor | 5 / 114246 | 43 | |
esophageal tumor | 2 / 17290 | 115 | |
gastrointestinal tumor | 6 / 119369 | 50 | |
germ cell tumor | 3 / 263845 | 11 | |
glioma | 9 / 106883 | 84 | |
head and neck tumor | 7 / 136302 | 51 | |
kidney tumor | 3 / 68959 | 43 | |
leukemia | 3 / 95842 | 31 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 9 / 103127 | 87 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 6 / 97250 | 61 | |
normal | 232 / 3360307 | 69 | |
ovarian tumor | 5 / 76682 | 65 | |
pancreatic tumor | 1 / 104616 | 9 | |
primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | |
prostate cancer | 1 / 102680 | 9 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 2 / 124949 | 16 | |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 10 / 90257 | 110 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 1 / 33197 | 30 | |
ascites | 2 / 40015 | 49 | |
bladder | 0 / 29757 | 0 | |
blood | 11 / 123478 | 89 | |
bone | 6 / 71655 | 83 | |
bone marrow | 1 / 48801 | 20 | |
brain | 95 / 1100989 | 86 | |
cervix | 2 / 48171 | 41 | |
connective tissue | 7 / 149255 | 46 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 10 / 215722 | 46 | |
esophagus | 2 / 20209 | 98 | |
eye | 10 / 211054 | 47 | |
heart | 3 / 89626 | 33 | |
intestine | 7 / 234472 | 29 | |
kidney | 11 / 211777 | 51 | |
larynx | 2 / 24145 | 82 | |
liver | 8 / 207743 | 38 | |
lung | 23 / 336974 | 68 | |
lymph | 0 / 44270 | 0 | |
lymph node | 9 / 91610 | 98 | |
mammary gland | 7 / 153271 | 45 | |
mouth | 4 / 67052 | 59 | |
muscle | 5 / 107715 | 46 | |
nerve | 0 / 15768 | 0 | |
ovary | 6 / 102051 | 58 | |
pancreas | 4 / 214812 | 18 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 2 / 41328 | 48 | |
pituitary gland | 2 / 16585 | 120 | |
placenta | 11 / 280825 | 39 | |
prostate | 1 / 189345 | 5 | |
salivary gland | 0 / 20155 | 0 | |
skin | 8 / 210574 | 37 | |
spleen | 8 / 53952 | 148 | |
stomach | 7 / 96619 | 72 | |
testis | 25 / 330442 | 75 | |
thymus | 3 / 81131 | 36 | |
thyroid | 3 / 47473 | 63 | |
tonsil | 0 / 16999 | 0 | |
trachea | 5 / 52413 | 95 | |
umbilical cord | 4 / 13680 | 292 | |
uterus | 10 / 232878 | 42 | |
vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202255_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 59.2 | |
Adipocyte | 16.8 | |
AdrenalCortex | 26.5 | |
Adrenalgland | 41.85 | |
Amygdala | 83.35 | |
Appendix | 31 | |
AtrioventricularNode | 23.3 | |
BDCA4+_DentriticCells | 23.45 | |
Bonemarrow | 30.1 | |
BronchialEpithelialCells | 31.95 | |
CD105+_Endothelial | 6.3 | |
CD14+_Monocytes | 58.35 | |
CD19+_BCells(neg._sel.) | 98.8 | |
CD33+_Myeloid | 45.3 | |
CD34+ | 7.35 | |
CD4+_Tcells | 33.55 | |
CD56+_NKCells | 37.05 | |
CD71+_EarlyErythroid | 37.65 | |
CD8+_Tcells | 36.2 | |
CardiacMyocytes | 38.65 | |
Caudatenucleus | 71.8 | |
Cerebellum | 33.1 | |
CerebellumPeduncles | 41.4 | |
CiliaryGanglion | 25.6 | |
CingulateCortex | 42.8 | |
Colorectaladenocarcinoma | 31.5 | |
DorsalRootGanglion | 27.6 | |
FetalThyroid | 28.9 | |
Fetalbrain | 20.3 | |
Fetalliver | 26.55 | |
Fetallung | 27.75 | |
GlobusPallidus | 37.1 | |
Heart | 38.8 | |
Hypothalamus | 36.9 | |
Kidney | 29.55 | |
Leukemia_chronicMyelogenousK-562 | 25 | |
Leukemia_promyelocytic-HL-60 | 25.7 | |
Leukemialymphoblastic(MOLT-4) | 21.1 | |
Liver | 39.2 | |
Lung | 23.95 | |
Lymphnode | 26.85 | |
Lymphoma_burkitts(Daudi) | 41 | |
Lymphoma_burkitts(Raji) | 42.45 | |
MedullaOblongata | 49.4 | |
OccipitalLobe | 46.5 | |
OlfactoryBulb | 37.6 | |
Ovary | 26.35 | |
Pancreas | 21.75 | |
PancreaticIslet | 28.8 | |
ParietalLobe | 40.1 | |
Pituitary | 68.9 | |
Placenta | 48.55 | |
Pons | 41.75 | |
PrefrontalCortex | 124.15 | |
Prostate | 28.95 | |
Salivarygland | 20.6 | |
SkeletalMuscle | 35.05 | |
Skin | 23.05 | |
SmoothMuscle | 179.15 | |
Spinalcord | 47.95 | |
SubthalamicNucleus | 42.45 | |
SuperiorCervicalGanglion | 34.35 | |
TemporalLobe | 32.45 | |
Testis | 44.9 | |
TestisGermCell | 35.1 | |
TestisIntersitial | 21.3 | |
TestisLeydigCell | 31.2 | |
TestisSeminiferousTubule | 33.5 | |
Thalamus | 22.85 | |
Thymus | 25.1 | |
Thyroid | 39 | |
Tongue | 32.9 | |
Tonsil | 30 | |
Trachea | 30.9 | |
TrigeminalGanglion | 30.1 | |
Uterus | 23.3 | |
UterusCorpus | 27.35 | |
WholeBlood | 71.15 | |
Wholebrain | 47.85 | |
colon | 33.7 | |
pineal_day | 24.18 | |
pineal_night | 21.62 | |
retina | 37.275 | |
small_intestine | 31 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_24_P344053
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.96 ± 0.53 | |
Basal Forebrain | 5.81 ± 0.37 | |
Basal Part of Pons | 5.62 ± 0.52 | |
Cerebellar Cortex | 5.45 ± 0.39 | |
Cerebellar Nuclei | 4.83 ± 0.85 | |
Claustrum | 5.53 ± 0.48 | |
Epithalamus | 5.66 ± 0.7 | |
Frontal Lobe | 5.43 ± 0.58 | |
Globus Pallidus | 3.98 ± 0.56 | |
Hypothalamus | 5.13 ± 0.52 | |
Insula | 5.59 ± 0.51 | |
Limbic Lobe | 5.73 ± 0.69 | |
Mesencephalon | 5.22 ± 0.6 | |
Myelencephalon | 5.41 ± 0.64 | |
Occipital Lobe | 5.53 ± 0.59 | |
Parietal Lobe | 5.55 ± 0.58 | |
Pontine Tegmentum | 5.41 ± 0.63 | |
Striatum | 6.19 ± 0.54 | |
Subthalamus | 5.09 ± 0.37 | |
Temporal Lobe | 5.62 ± 0.54 | |
Thalamus | 4.88 ± 0.68 | |
White Matter | 3.58 ± 0.87 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Sipa1l1 | CB | Cerebellum | 52.13 | |
61.62 | ||||
Sipa1l1 | CTX | Cerebral cortex | 100 | |
100 | ||||
Sipa1l1 | HIP | Hippocampal region | 100 | |
100 | ||||
Sipa1l1 | HPF | Hippocampal formation | 97.75 | |
100 | ||||
Sipa1l1 | HY | Hypothalamus | 26.67 | |
23.17 | ||||
Sipa1l1 | LSX | Lateral septal complex | 98.91 | |
96.01 | ||||
Sipa1l1 | MB | Midbrain | 26.88 | |
27.5 | ||||
Sipa1l1 | MY | Medulla | 37.52 | |
44.04 | ||||
Sipa1l1 | OLF | Olfactory bulb | 100 | |
100 | ||||
Sipa1l1 | P | Pons | 25.64 | |
28.61 | ||||
Sipa1l1 | PAL | Pallidum | 45.6 | |
47.44 | ||||
Sipa1l1 | RHP | Retrohippocampal region | 94.25 | |
99.3 | ||||
Sipa1l1 | sAMY | Striatum-like amygdalar nuclei | 84.13 | |
83.1 | ||||
Sipa1l1 | STR | Striatum | 100 | |
100 | ||||
Sipa1l1 | STRd | Striatum dorsal region | 100 | |
100 | ||||
Sipa1l1 | STRv | Striatum ventral region | 100 | |
100 | ||||
Sipa1l1 | TH | Thalamus | 23.91 | |
27.22 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00000691 | 32 | 1694 | 1725 | ASFFAASDENHRPLSAASNSDQLEDQALAQMK | Peptide Atlas |
SI1L1_HUMAN_1170 | 10 | 1170 | 1179 | SMPEGFGVSR | PRIDE |
SI1L1_HUMAN_1489 | 15 | 1489 | 1503 | KPEGTINSVGFMDTR | PRIDE |