Annotation Detail for MSH6
Basic Information Top
| Gene Symbol: | MSH6 ( GTBP,HNPCC5,HSAP ) |
|---|---|
| Gene Full Name: | mutS homolog 6 (E. coli) |
| Band: | 2p16.3 |
| Quick Links | Entrez ID:2956; OMIM: 600678; Uniprot ID:MSH6_HUMAN; ENSEMBL ID: ENSG00000116062; HGNC ID: 7329 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.445052
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
 | |||
| embryoid body | 16 / 70761 | 226 |  |
| blastocyst | 17 / 62319 | 272 | |
| fetus | 33 / 564012 | 58 |  |
| neonate | 2 / 31097 | 64 | |
| infant | 2 / 23620 | 84 | |
| juvenile | 3 / 55556 | 53 | |
| adult | 162 / 1939121 | 83 | |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
| |||
| adrenal tumor | 2 / 12794 | 156 | |
| bladder carcinoma | 1 / 17475 | 57 | |
| breast (mammary gland) tumor | 8 / 94178 | 84 | |
| cervical tumor | 2 / 34366 | 58 | |
| chondrosarcoma | 7 / 82823 | 84 | |
| colorectal tumor | 2 / 114246 | 17 |  |
| esophageal tumor | 1 / 17290 | 57 | |
| gastrointestinal tumor | 9 / 119369 | 75 | |
| germ cell tumor | 54 / 263845 | 204 | |
| glioma | 3 / 106883 | 28 | |
| head and neck tumor | 8 / 136302 | 58 | |
| kidney tumor | 2 / 68959 | 29 | |
| leukemia | 4 / 95842 | 41 | |
| liver tumor | 9 / 96359 | 93 | |
| lung tumor | 7 / 103127 | 67 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 6 / 97250 | 61 | |
| normal | 223 / 3360307 | 66 | |
| ovarian tumor | 9 / 76682 | 117 | |
| pancreatic tumor | 3 / 104616 | 28 | |
| primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | |
| prostate cancer | 7 / 102680 | 68 | |
| retinoblastoma | 8 / 46356 | 172 | |
| skin tumor | 14 / 124949 | 112 | |
| soft tissue/muscle tissue tumor | 14 / 125191 | 111 | |
| uterine tumor | 5 / 90257 | 55 | |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
| |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 3 / 33197 | 90 | |
| ascites | 6 / 40015 | 149 | |
| bladder | 4 / 29757 | 134 | |
| blood | 4 / 123478 | 32 | |
| bone | 6 / 71655 | 83 | |
| bone marrow | 4 / 48801 | 81 | |
| brain | 52 / 1100989 | 47 | |
| cervix | 4 / 48171 | 83 | |
| connective tissue | 6 / 149255 | 40 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 45 / 215722 | 208 | |
| esophagus | 1 / 20209 | 49 | |
| eye | 36 / 211054 | 170 | |
| heart | 7 / 89626 | 78 | |
| intestine | 8 / 234472 | 34 | |
| kidney | 9 / 211777 | 42 | |
| larynx | 3 / 24145 | 124 | |
| liver | 16 / 207743 | 77 | |
| lung | 19 / 336974 | 56 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 13 / 91610 | 141 | |
| mammary gland | 10 / 153271 | 65 | |
| mouth | 1 / 67052 | 14 | |
| muscle | 6 / 107715 | 55 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 11 / 102051 | 107 | |
| pancreas | 6 / 214812 | 27 | |
| parathyroid | 2 / 20539 | 97 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 27 / 280825 | 96 | |
| prostate | 9 / 189345 | 47 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 16 / 210574 | 75 | |
| spleen | 3 / 53952 | 55 | |
| stomach | 6 / 96619 | 62 | |
| testis | 72 / 330442 | 217 | |
| thymus | 5 / 81131 | 61 | |
| thyroid | 4 / 47473 | 84 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 7 / 52413 | 133 | |
| umbilical cord | 1 / 13680 | 73 | |
| uterus | 20 / 232878 | 85 | |
| vascular | 1 / 51780 | 19 | |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 211450_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
| ||
| 721_B_lymphoblasts | 170.2 | |
| Adipocyte | 4.3 |  |
| AdrenalCortex | 4.8 | |
| Adrenalgland | 3.7 | |
| Amygdala | 4.5 | |
| Appendix | 4.5 | |
| AtrioventricularNode | 3.55 | |
| BDCA4+_DentriticCells | 16.75 | |
| Bonemarrow | 4.5 | |
| BronchialEpithelialCells | 4.35 | |
| CD105+_Endothelial | 23.15 | |
| CD14+_Monocytes | 4.65 | |
| CD19+_BCells(neg._sel.) | 4.6 | |
| CD33+_Myeloid | 6.5 | |
| CD34+ | 129.25 | |
| CD4+_Tcells | 5.8 | |
| CD56+_NKCells | 6.5 | |
| CD71+_EarlyErythroid | 19.5 | |
| CD8+_Tcells | 7 | |
| CardiacMyocytes | 6.25 | |
| Caudatenucleus | 3.9 | |
| Cerebellum | 3.55 | |
| CerebellumPeduncles | 5 | |
| CiliaryGanglion | 3.25 | |
| CingulateCortex | 4.5 | |
| Colorectaladenocarcinoma | 8.15 | |
| DorsalRootGanglion | 3.5 | |
| FetalThyroid | 4.25 | |
| Fetalbrain | 4.35 | |
| Fetalliver | 4.3 | |
| Fetallung | 3.55 | |
| GlobusPallidus | 3.25 | |
| Heart | 5.9 | |
| Hypothalamus | 4.65 | |
| Kidney | 3.65 | |
| Leukemia_chronicMyelogenousK-562 | 4.65 | |
| Leukemia_promyelocytic-HL-60 | 22.85 | |
| Leukemialymphoblastic(MOLT-4) | 22.95 | |
| Liver | 5.95 | |
| Lung | 4.75 | |
| Lymphnode | 3.7 | |
| Lymphoma_burkitts(Daudi) | 28.95 | |
| Lymphoma_burkitts(Raji) | 6.45 | |
| MedullaOblongata | 4 | |
| OccipitalLobe | 3.9 | |
| OlfactoryBulb | 3.45 | |
| Ovary | 3 | |
| Pancreas | 3.55 | |
| PancreaticIslet | 4.7 | |
| ParietalLobe | 4.75 | |
| Pituitary | 5.15 | |
| Placenta | 4.45 | |
| Pons | 4.25 | |
| PrefrontalCortex | 5.35 | |
| Prostate | 5.1 | |
| Salivarygland | 3.6 | |
| SkeletalMuscle | 5.45 | |
| Skin | 3.45 | |
| SmoothMuscle | 6.05 | |
| Spinalcord | 4.65 | |
| SubthalamicNucleus | 4.05 | |
| SuperiorCervicalGanglion | 5.15 | |
| TemporalLobe | 4.05 | |
| Testis | 4.25 | |
| TestisGermCell | 7.85 | |
| TestisIntersitial | 6.3 | |
| TestisLeydigCell | 6.75 | |
| TestisSeminiferousTubule | 3.8 | |
| Thalamus | 4.45 | |
| Thymus | 3.4 | |
| Thyroid | 5.45 | |
| Tongue | 4.4 | |
| Tonsil | 5.55 | |
| Trachea | 3.65 | |
| TrigeminalGanglion | 4.6 | |
| Uterus | 4.45 | |
| UterusCorpus | 4.4 | |
| WholeBlood | 4.75 | |
| Wholebrain | 3.6 | |
| colon | 4.4 | |
| pineal_day | 5.42 | |
| pineal_night | 5.3 | |
| retina | 5.325 | |
| small_intestine | 4.2 | |
- Probe name: CUST_15605_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 6.37 ± 0.37 | ![](../"images/bar_3.png"){kind=small}   |
| Basal Forebrain | 6.73 ± 0.31 | |
| Basal Part of Pons | 6.67 ± 0.32 | |
| Cerebellar Cortex | 7.06 ± 0.13 | |
| Cerebellar Nuclei | 7.03 ± 0.5 | |
| Claustrum | 6.35 ± 0.63 | |
| Epithalamus | 7.23 ± 0.28 | |
| Frontal Lobe | 6.76 ± 0.36 | |
| Globus Pallidus | 7.03 ± 0.37 | |
| Hypothalamus | 6.87 ± 0.29 | |
| Insula | 6.73 ± 0.19 | |
| Limbic Lobe | 6.46 ± 0.32 | |
| Mesencephalon | 6.66 ± 0.43 | |
| Myelencephalon | 6.69 ± 0.4 | |
| Occipital Lobe | 6.54 ± 0.31 | |
| Parietal Lobe | 6.64 ± 0.4 | |
| Pontine Tegmentum | 6.82 ± 0.33 | |
| Striatum | 6.52 ± 0.35 | |
| Subthalamus | 7.02 ± 0.37 | |
| Temporal Lobe | 6.68 ± 0.3 | |
| Thalamus | 6.75 ± 0.36 | |
| White Matter | 8.08 ± 0.33 | |
Mouse Brain ISH 
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Msh6 | CB | Cerebellum | 13.77 | |
| 14.23 | | |||
| Msh6 | CTX | Cerebral cortex | 7.66 | |
| 5.7 | | |||
| Msh6 | HIP | Hippocampal region | 11.21 | |
| 10.31 | | |||
| Msh6 | HPF | Hippocampal formation | 10.22 | |
| 8.64 | | |||
| Msh6 | HY | Hypothalamus | 1.41 | |
| 1.22 | | |||
| Msh6 | LSX | Lateral septal complex | 1.51 | |
| 1.09 | | |||
| Msh6 | MB | Midbrain | 5.21 | |
| 4.88 | | |||
| Msh6 | MY | Medulla | 14.27 | |
| 16.74 | | |||
| Msh6 | OLF | Olfactory bulb | 12.45 | |
| 9.38 | | |||
| Msh6 | P | Pons | 9.07 | |
| 10.21 | | |||
| Msh6 | PAL | Pallidum | 2.4 | |
| 2.11 | | |||
| Msh6 | RHP | Retrohippocampal region | 9.01 | |
| 6.65 | | |||
| Msh6 | sAMY | Striatum-like amygdalar nuclei | 0.44 | |
| 0.32 | | |||
| Msh6 | STR | Striatum | 1.68 | |
| 1.35 | | |||
| Msh6 | STRd | Striatum dorsal region | 1.23 | |
| 1.16 | | |||
| Msh6 | STRv | Striatum ventral region | 3.64 | |
| 2.33 | | |||
| Msh6 | TH | Thalamus | 3.54 | |
| 3.01 | |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| MSH6_HUMAN_1077 | 19 | 1077 | 1095 | PVILLPEDTPPFLELKGSR | PRIDE |
| MSH6_HUMAN_129 | 12 | 129 | 140 | VHVQFFDDSPTR | PRIDE |
| MSH6_HUMAN_722 | 11 | 722 | 732 | SGAIFTKAYQR | PRIDE |
| PAp00063258 | 36 | 339 | 374 | AFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLK | Peptide Atlas |