Annotation Detail for GTF2H1
Basic Information Top
| Gene Symbol: | GTF2H1 ( BTF2,TFB1,TFIIH ) |
|---|---|
| Gene Full Name: | general transcription factor IIH, polypeptide 1, 62kDa |
| Band: | 11p15.1 |
| Quick Links | Entrez ID:2965; OMIM: 189972; Uniprot ID:TF2H1_HUMAN; ENSEMBL ID: ENSG00000110768; HGNC ID: 4655 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.577202
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 1 / 70761 | 14 | |
| blastocyst | 1 / 62319 | 16 | |
| fetus | 68 / 564012 | 120 | |
| neonate | 3 / 31097 | 96 | |
| infant | 7 / 23620 | 296 | |
| juvenile | 8 / 55556 | 143 | |
| adult | 106 / 1939121 | 54 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 2 / 17475 | 114 | |
| breast (mammary gland) tumor | 6 / 94178 | 63 | |
| cervical tumor | 3 / 34366 | 87 | |
| chondrosarcoma | 8 / 82823 | 96 | |
| colorectal tumor | 4 / 114246 | 35 | |
| esophageal tumor | 4 / 17290 | 231 | |
| gastrointestinal tumor | 8 / 119369 | 67 | |
| germ cell tumor | 28 / 263845 | 106 | |
| glioma | 9 / 106883 | 84 | |
| head and neck tumor | 5 / 136302 | 36 | |
| kidney tumor | 2 / 68959 | 29 | |
| leukemia | 6 / 95842 | 62 | |
| liver tumor | 4 / 96359 | 41 | |
| lung tumor | 3 / 103127 | 29 | |
| lymphoma | 8 / 71755 | 111 | |
| non-neoplasia | 11 / 97250 | 113 | |
| normal | 283 / 3360307 | 84 | |
| ovarian tumor | 5 / 76682 | 65 | |
| pancreatic tumor | 6 / 104616 | 57 | |
| primitive neuroectodermal tumor of the CNS | 13 / 125680 | 103 | |
| prostate cancer | 5 / 102680 | 48 | |
| retinoblastoma | 3 / 46356 | 64 | |
| skin tumor | 9 / 124949 | 72 | |
| soft tissue/muscle tissue tumor | 6 / 125191 | 47 | |
| uterine tumor | 8 / 90257 | 88 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 2 / 13106 | 152 | |
| adrenal gland | 3 / 33197 | 90 | |
| ascites | 3 / 40015 | 74 | |
| bladder | 5 / 29757 | 168 | |
| blood | 7 / 123478 | 56 | |
| bone | 9 / 71655 | 125 | |
| bone marrow | 5 / 48801 | 102 | |
| brain | 108 / 1100989 | 98 | |
| cervix | 3 / 48171 | 62 | |
| connective tissue | 16 / 149255 | 107 | |
| ear | 1 / 16212 | 61 | |
| embryonic tissue | 5 / 215722 | 23 | |
| esophagus | 4 / 20209 | 197 | |
| eye | 19 / 211054 | 90 | |
| heart | 9 / 89626 | 100 | |
| intestine | 9 / 234472 | 38 | |
| kidney | 21 / 211777 | 99 | |
| larynx | 0 / 24145 | 0 | |
| liver | 9 / 207743 | 43 | |
| lung | 18 / 336974 | 53 | |
| lymph | 2 / 44270 | 45 | |
| lymph node | 10 / 91610 | 109 | |
| mammary gland | 10 / 153271 | 65 | |
| mouth | 6 / 67052 | 89 | |
| muscle | 1 / 107715 | 9 | |
| nerve | 3 / 15768 | 190 | |
| ovary | 7 / 102051 | 68 | |
| pancreas | 11 / 214812 | 51 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 4 / 280825 | 14 | |
| prostate | 15 / 189345 | 79 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 24 / 210574 | 113 | |
| spleen | 5 / 53952 | 92 | |
| stomach | 7 / 96619 | 72 | |
| testis | 38 / 330442 | 114 | |
| thymus | 9 / 81131 | 110 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 1 / 52413 | 19 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 21 / 232878 | 90 | |
| vascular | 14 / 51780 | 270 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202453_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 64.9 | |
| Adipocyte | 9.8 | |
| AdrenalCortex | 7.85 | |
| Adrenalgland | 6.25 | |
| Amygdala | 7.75 | |
| Appendix | 7.5 | |
| AtrioventricularNode | 5.8 | |
| BDCA4+_DentriticCells | 10.95 | |
| Bonemarrow | 7.3 | |
| BronchialEpithelialCells | 22.3 | |
| CD105+_Endothelial | 7.7 | |
| CD14+_Monocytes | 12.65 | |
| CD19+_BCells(neg._sel.) | 12.75 | |
| CD33+_Myeloid | 10.3 | |
| CD34+ | 15.65 | |
| CD4+_Tcells | 15.95 | |
| CD56+_NKCells | 8.95 | |
| CD71+_EarlyErythroid | 7.45 | |
| CD8+_Tcells | 12.7 | |
| CardiacMyocytes | 10.9 | |
| Caudatenucleus | 6.7 | |
| Cerebellum | 6.1 | |
| CerebellumPeduncles | 8.5 | |
| CiliaryGanglion | 5.2 | |
| CingulateCortex | 7.55 | |
| Colorectaladenocarcinoma | 7.55 | |
| DorsalRootGanglion | 5.7 | |
| FetalThyroid | 7.25 | |
| Fetalbrain | 7.55 | |
| Fetalliver | 6.5 | |
| Fetallung | 6.05 | |
| GlobusPallidus | 5.55 | |
| Heart | 9.35 | |
| Hypothalamus | 8.15 | |
| Kidney | 6 | |
| Leukemia_chronicMyelogenousK-562 | 7.2 | |
| Leukemia_promyelocytic-HL-60 | 7 | |
| Leukemialymphoblastic(MOLT-4) | 6.3 | |
| Liver | 9.8 | |
| Lung | 6.9 | |
| Lymphnode | 6.55 | |
| Lymphoma_burkitts(Daudi) | 16.1 | |
| Lymphoma_burkitts(Raji) | 10.4 | |
| MedullaOblongata | 6.9 | |
| OccipitalLobe | 9.45 | |
| OlfactoryBulb | 5.9 | |
| Ovary | 4.95 | |
| Pancreas | 6 | |
| PancreaticIslet | 8 | |
| ParietalLobe | 7.95 | |
| Pituitary | 8.85 | |
| Placenta | 7.55 | |
| Pons | 7.15 | |
| PrefrontalCortex | 8.65 | |
| Prostate | 8.05 | |
| Salivarygland | 7.3 | |
| SkeletalMuscle | 8.85 | |
| Skin | 5.8 | |
| SmoothMuscle | 13.8 | |
| Spinalcord | 7.95 | |
| SubthalamicNucleus | 7.65 | |
| SuperiorCervicalGanglion | 8.45 | |
| TemporalLobe | 6.8 | |
| Testis | 6.8 | |
| TestisGermCell | 23.25 | |
| TestisIntersitial | 23.4 | |
| TestisLeydigCell | 17.65 | |
| TestisSeminiferousTubule | 9.35 | |
| Thalamus | 7.55 | |
| Thymus | 5.9 | |
| Thyroid | 9.35 | |
| Tongue | 7.35 | |
| Tonsil | 9.05 | |
| Trachea | 6.45 | |
| TrigeminalGanglion | 7.45 | |
| Uterus | 6.05 | |
| UterusCorpus | 8.7 | |
| WholeBlood | 8.3 | |
| Wholebrain | 5 | |
| colon | 7.45 | |
| pineal_day | 10.36 | |
| pineal_night | 9.28 | |
| retina | 8.65 | |
| small_intestine | 7.2 |
- Probe name: A_23_P36183
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 7.71 ± 0.29 | |
| Basal Forebrain | 7.42 ± 0.19 | |
| Basal Part of Pons | 7.56 ± 0.31 | |
| Cerebellar Cortex | 7.39 ± 0.34 | |
| Cerebellar Nuclei | 7.48 ± 0.21 | |
| Claustrum | 7.9 ± 0.25 | |
| Epithalamus | 7.12 ± 0.27 | |
| Frontal Lobe | 7.49 ± 0.26 | |
| Globus Pallidus | 7.47 ± 0.14 | |
| Hypothalamus | 7.32 ± 0.24 | |
| Insula | 7.52 ± 0.23 | |
| Limbic Lobe | 7.62 ± 0.25 | |
| Mesencephalon | 7.49 ± 0.28 | |
| Myelencephalon | 7.45 ± 0.27 | |
| Occipital Lobe | 7.55 ± 0.24 | |
| Parietal Lobe | 7.52 ± 0.25 | |
| Pontine Tegmentum | 7.5 ± 0.26 | |
| Striatum | 7.45 ± 0.26 | |
| Subthalamus | 7.49 ± 0.11 | |
| Temporal Lobe | 7.51 ± 0.21 | |
| Thalamus | 7.43 ± 0.22 | |
| White Matter | 7.36 ± 0.3 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Gtf2h1 | CB | Cerebellum | 3.51 | |
| 4 | ||||
| Gtf2h1 | CTX | Cerebral cortex | 13.6 | |
| 9.72 | ||||
| Gtf2h1 | HIP | Hippocampal region | 20.26 | |
| 19.13 | ||||
| Gtf2h1 | HPF | Hippocampal formation | 17.57 | |
| 15.48 | ||||
| Gtf2h1 | HY | Hypothalamus | 5.12 | |
| 3.94 | ||||
| Gtf2h1 | LSX | Lateral septal complex | 3.53 | |
| 2.59 | ||||
| Gtf2h1 | MB | Midbrain | 1.93 | |
| 1.93 | ||||
| Gtf2h1 | MY | Medulla | 3.31 | |
| 5.24 | ||||
| Gtf2h1 | OLF | Olfactory bulb | 22.75 | |
| 19.92 | ||||
| Gtf2h1 | P | Pons | 4.57 | |
| 7.2 | ||||
| Gtf2h1 | PAL | Pallidum | 4.65 | |
| 3.76 | ||||
| Gtf2h1 | RHP | Retrohippocampal region | 11.68 | |
| 9.38 | ||||
| Gtf2h1 | sAMY | Striatum-like amygdalar nuclei | 15.15 | |
| 14.13 | ||||
| Gtf2h1 | STR | Striatum | 7.07 | |
| 5.74 | ||||
| Gtf2h1 | STRd | Striatum dorsal region | 3.23 | |
| 2.05 | ||||
| Gtf2h1 | STRv | Striatum ventral region | 15.82 | |
| 12.81 | ||||
| Gtf2h1 | TH | Thalamus | 4.2 | |
| 3.1 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00010634 | 30 | 321 | 350 | KQEAQNEQTSEPSNMDGNSGDADCFQPAVK | Peptide Atlas |
| TF2H1_HUMAN_2 | 15 | 2 | 16 | ATSSEEVLLIVKKVR | PRIDE |



