Annotation Detail for HYAL1
Basic Information Top
| Gene Symbol: | HYAL1 ( HYAL-1,LUCA1,MGC45987,NAT6 ) |
|---|---|
| Gene Full Name: | hyaluronoglucosaminidase 1 |
| Band: | 3p21.31 |
| Quick Links | Entrez ID:3373; OMIM: 607071; Uniprot ID:HYAL1_HUMAN; ENSEMBL ID: ENSG00000114378; HGNC ID: 5320 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.75619
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 0 / 70761 | 0 | |
| blastocyst | 0 / 62319 | 0 | |
| fetus | 12 / 564012 | 21 | |
| neonate | 1 / 31097 | 32 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 0 / 55556 | 0 | |
| adult | 49 / 1939121 | 25 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 1 / 94178 | 10 | |
| cervical tumor | 2 / 34366 | 58 | |
| chondrosarcoma | 1 / 82823 | 12 | |
| colorectal tumor | 1 / 114246 | 8 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 4 / 119369 | 33 | |
| germ cell tumor | 2 / 263845 | 7 | |
| glioma | 0 / 106883 | 0 | |
| head and neck tumor | 1 / 136302 | 7 | |
| kidney tumor | 3 / 68959 | 43 | |
| leukemia | 0 / 95842 | 0 | |
| liver tumor | 9 / 96359 | 93 | |
| lung tumor | 1 / 103127 | 9 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 5 / 97250 | 51 | |
| normal | 150 / 3360307 | 44 | |
| ovarian tumor | 2 / 76682 | 26 | |
| pancreatic tumor | 6 / 104616 | 57 | |
| primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
| prostate cancer | 0 / 102680 | 0 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
| uterine tumor | 0 / 90257 | 0 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 6 / 33197 | 180 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 1 / 29757 | 33 | |
| blood | 1 / 123478 | 8 | |
| bone | 0 / 71655 | 0 | |
| bone marrow | 0 / 48801 | 0 | |
| brain | 14 / 1100989 | 12 | |
| cervix | 10 / 48171 | 207 | |
| connective tissue | 5 / 149255 | 33 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 0 / 215722 | 0 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 0 / 211054 | 0 | |
| heart | 13 / 89626 | 145 | |
| intestine | 8 / 234472 | 34 | |
| kidney | 27 / 211777 | 127 | |
| larynx | 0 / 24145 | 0 | |
| liver | 25 / 207743 | 120 | |
| lung | 16 / 336974 | 47 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 4 / 153271 | 26 | |
| mouth | 2 / 67052 | 29 | |
| muscle | 1 / 107715 | 9 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 2 / 102051 | 19 | |
| pancreas | 8 / 214812 | 37 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 0 / 280825 | 0 | |
| prostate | 4 / 189345 | 21 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 0 / 210574 | 0 | |
| spleen | 25 / 53952 | 463 | |
| stomach | 6 / 96619 | 62 | |
| testis | 4 / 330442 | 12 | |
| thymus | 2 / 81131 | 24 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 1 / 52413 | 19 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 3 / 232878 | 12 | |
| vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 210619_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 5.1 | |
| Adipocyte | 4.5 | |
| AdrenalCortex | 5.4 | |
| Adrenalgland | 7.95 | |
| Amygdala | 4.65 | |
| Appendix | 4.55 | |
| AtrioventricularNode | 3.6 | |
| BDCA4+_DentriticCells | 4.5 | |
| Bonemarrow | 4.5 | |
| BronchialEpithelialCells | 4.5 | |
| CD105+_Endothelial | 4.4 | |
| CD14+_Monocytes | 4.75 | |
| CD19+_BCells(neg._sel.) | 4.8 | |
| CD33+_Myeloid | 5.8 | |
| CD34+ | 5.5 | |
| CD4+_Tcells | 4.6 | |
| CD56+_NKCells | 4.9 | |
| CD71+_EarlyErythroid | 4.2 | |
| CD8+_Tcells | 4.2 | |
| CardiacMyocytes | 5.75 | |
| Caudatenucleus | 4.1 | |
| Cerebellum | 3.7 | |
| CerebellumPeduncles | 5.15 | |
| CiliaryGanglion | 3.25 | |
| CingulateCortex | 4.65 | |
| Colorectaladenocarcinoma | 4.6 | |
| DorsalRootGanglion | 3.55 | |
| FetalThyroid | 6.95 | |
| Fetalbrain | 4.5 | |
| Fetalliver | 43.8 | |
| Fetallung | 5.35 | |
| GlobusPallidus | 3.45 | |
| Heart | 29.5 | |
| Hypothalamus | 4.85 | |
| Kidney | 64.75 | |
| Leukemia_chronicMyelogenousK-562 | 4.1 | |
| Leukemia_promyelocytic-HL-60 | 3.95 | |
| Leukemialymphoblastic(MOLT-4) | 3.55 | |
| Liver | 351 | |
| Lung | 25.05 | |
| Lymphnode | 4.05 | |
| Lymphoma_burkitts(Daudi) | 5.75 | |
| Lymphoma_burkitts(Raji) | 6.35 | |
| MedullaOblongata | 4.25 | |
| OccipitalLobe | 4.1 | |
| OlfactoryBulb | 3.6 | |
| Ovary | 3 | |
| Pancreas | 4.25 | |
| PancreaticIslet | 4.95 | |
| ParietalLobe | 4.95 | |
| Pituitary | 5.35 | |
| Placenta | 4.8 | |
| Pons | 4.35 | |
| PrefrontalCortex | 5.6 | |
| Prostate | 5.4 | |
| Salivarygland | 3.6 | |
| SkeletalMuscle | 5.35 | |
| Skin | 3.65 | |
| SmoothMuscle | 5.15 | |
| Spinalcord | 4.9 | |
| SubthalamicNucleus | 4.15 | |
| SuperiorCervicalGanglion | 10.4 | |
| TemporalLobe | 4.3 | |
| Testis | 3.9 | |
| TestisGermCell | 3.75 | |
| TestisIntersitial | 3.85 | |
| TestisLeydigCell | 4.7 | |
| TestisSeminiferousTubule | 3.95 | |
| Thalamus | 4.6 | |
| Thymus | 3.5 | |
| Thyroid | 5.75 | |
| Tongue | 4.45 | |
| Tonsil | 4.4 | |
| Trachea | 3.8 | |
| TrigeminalGanglion | 4.55 | |
| Uterus | 3.7 | |
| UterusCorpus | 4.1 | |
| WholeBlood | 4.9 | |
| Wholebrain | 3.85 | |
| colon | 4.55 | |
| pineal_day | 20.32 | |
| pineal_night | 14.54 | |
| retina | 5.5 | |
| small_intestine | 4.35 |
- Probe name: A_24_P208774
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 2.23 ± 1.29 | |
| Basal Forebrain | 1.68 ± 0.28 | |
| Basal Part of Pons | 1.33 ± 0.34 | |
| Cerebellar Cortex | 1.68 ± 0.88 | |
| Cerebellar Nuclei | 1.98 ± 0.7 | |
| Claustrum | 2.66 ± 0.94 | |
| Epithalamus | 1.48 ± 0.86 | |
| Frontal Lobe | 1.7 ± 0.77 | |
| Globus Pallidus | 2.09 ± 0.46 | |
| Hypothalamus | 1.86 ± 0.78 | |
| Insula | 1.43 ± 0.65 | |
| Limbic Lobe | 1.71 ± 0.7 | |
| Mesencephalon | 1.99 ± 0.81 | |
| Myelencephalon | 1.84 ± 0.73 | |
| Occipital Lobe | 1.87 ± 0.63 | |
| Parietal Lobe | 1.81 ± 1.01 | |
| Pontine Tegmentum | 1.86 ± 0.82 | |
| Striatum | 1.91 ± 0.79 | |
| Subthalamus | 1.91 ± 0.88 | |
| Temporal Lobe | 1.69 ± 0.76 | |
| Thalamus | 1.74 ± 0.64 | |
| White Matter | 1.89 ± 0.51 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Hyal1 | CB | Cerebellum | 0.28 | |
| 0.72 | ||||
| Hyal1 | CTX | Cerebral cortex | 0.83 | |
| 0.9 | ||||
| Hyal1 | HIP | Hippocampal region | 7.12 | |
| 6.95 | ||||
| Hyal1 | HPF | Hippocampal formation | 5.74 | |
| 5.17 | ||||
| Hyal1 | HY | Hypothalamus | 3.31 | |
| 3.15 | ||||
| Hyal1 | LSX | Lateral septal complex | 0.57 | |
| 0.4 | ||||
| Hyal1 | MB | Midbrain | 1 | |
| 2.27 | ||||
| Hyal1 | MY | Medulla | 0.66 | |
| 1.44 | ||||
| Hyal1 | OLF | Olfactory bulb | 1.61 | |
| 1.7 | ||||
| Hyal1 | P | Pons | 1.87 | |
| 2.88 | ||||
| Hyal1 | PAL | Pallidum | 2.93 | |
| 2.32 | ||||
| Hyal1 | RHP | Retrohippocampal region | 2.81 | |
| 2.11 | ||||
| Hyal1 | sAMY | Striatum-like amygdalar nuclei | 4.04 | |
| 2.88 | ||||
| Hyal1 | STR | Striatum | 1.47 | |
| 1.16 | ||||
| Hyal1 | STRd | Striatum dorsal region | 0.79 | |
| 0.75 | ||||
| Hyal1 | STRv | Striatum ventral region | 2.89 | |
| 2.02 | ||||
| Hyal1 | TH | Thalamus | 2.32 | |
| 2.38 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp01264415 | 41 | 68 | 108 | GPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLAR | Peptide Atlas |



