Annotation Detail for IFIT3


Gene Symbol: | IFIT3 ( CIG-49,GARG-49,IFI60,IFIT4,IRG2,ISG60,RIG-G ) |
---|---|
Gene Full Name: | interferon-induced protein with tetratricopeptide repeats 3 |
Band: | 10q23.31 |
Quick Links | Entrez ID:3437; OMIM: 604650; Uniprot ID:IFIT3_HUMAN; ENSEMBL ID: ENSG00000119917; HGNC ID: 5411 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.47338
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 1 / 564012 | 1 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 10 / 1939121 | 5 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | ![]() |
cervical tumor | 2 / 34366 | 58 | ![]() |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 1 / 114246 | 8 | ![]() |
esophageal tumor | 1 / 17290 | 57 | ![]() |
gastrointestinal tumor | 6 / 119369 | 50 | ![]() |
germ cell tumor | 2 / 263845 | 7 | ![]() |
glioma | 1 / 106883 | 9 | ![]() |
head and neck tumor | 3 / 136302 | 22 | ![]() |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 1 / 97250 | 10 | ![]() |
normal | 15 / 3360307 | 4 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 1 / 124949 | 8 | ![]() |
soft tissue/muscle tissue tumor | 4 / 125191 | 31 | ![]() |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 1 / 40015 | 24 | ![]() |
bladder | 0 / 29757 | 0 | |
blood | 3 / 123478 | 24 | ![]() |
bone | 0 / 71655 | 0 | |
bone marrow | 0 / 48801 | 0 | |
brain | 6 / 1100989 | 5 | ![]() |
cervix | 2 / 48171 | 41 | ![]() |
connective tissue | 1 / 149255 | 6 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 1 / 20209 | 49 | ![]() |
eye | 1 / 211054 | 4 | ![]() |
heart | 0 / 89626 | 0 | |
intestine | 1 / 234472 | 4 | ![]() |
kidney | 0 / 211777 | 0 | |
larynx | 0 / 24145 | 0 | |
liver | 0 / 207743 | 0 | |
lung | 2 / 336974 | 5 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 2 / 91610 | 21 | ![]() |
mammary gland | 1 / 153271 | 6 | ![]() |
mouth | 3 / 67052 | 44 | ![]() |
muscle | 2 / 107715 | 18 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 1 / 41328 | 24 | ![]() |
pituitary gland | 0 / 16585 | 0 | |
placenta | 1 / 280825 | 3 | ![]() |
prostate | 0 / 189345 | 0 | |
salivary gland | 0 / 20155 | 0 | |
skin | 1 / 210574 | 4 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 3 / 96619 | 31 | ![]() |
testis | 0 / 330442 | 0 | |
thymus | 0 / 81131 | 0 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 5 / 232878 | 21 | ![]() |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 204747_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 136.05 | ![]() |
Adipocyte | 5.4 | ![]() |
AdrenalCortex | 5.75 | ![]() |
Adrenalgland | 4.7 | ![]() |
Amygdala | 5.9 | ![]() |
Appendix | 5.4 | ![]() |
AtrioventricularNode | 4.35 | ![]() |
BDCA4+_DentriticCells | 6.15 | ![]() |
Bonemarrow | 5.3 | ![]() |
BronchialEpithelialCells | 4.95 | ![]() |
CD105+_Endothelial | 5.45 | ![]() |
CD14+_Monocytes | 6.45 | ![]() |
CD19+_BCells(neg._sel.) | 5.65 | ![]() |
CD33+_Myeloid | 7.1 | ![]() |
CD34+ | 6.75 | ![]() |
CD4+_Tcells | 5.7 | ![]() |
CD56+_NKCells | 6.85 | ![]() |
CD71+_EarlyErythroid | 5 | ![]() |
CD8+_Tcells | 5.05 | ![]() |
CardiacMyocytes | 6.7 | ![]() |
Caudatenucleus | 6.2 | ![]() |
Cerebellum | 4.4 | ![]() |
CerebellumPeduncles | 6.15 | ![]() |
CiliaryGanglion | 5.1 | ![]() |
CingulateCortex | 5.5 | ![]() |
Colorectaladenocarcinoma | 5.3 | ![]() |
DorsalRootGanglion | 5.05 | ![]() |
FetalThyroid | 5.15 | ![]() |
Fetalbrain | 5.35 | ![]() |
Fetalliver | 4.7 | ![]() |
Fetallung | 4.45 | ![]() |
GlobusPallidus | 4.05 | ![]() |
Heart | 7.35 | ![]() |
Hypothalamus | 7 | ![]() |
Kidney | 4.4 | ![]() |
Leukemia_chronicMyelogenousK-562 | 4.9 | ![]() |
Leukemia_promyelocytic-HL-60 | 4.55 | ![]() |
Leukemialymphoblastic(MOLT-4) | 4.4 | ![]() |
Liver | 7.1 | ![]() |
Lung | 6.35 | ![]() |
Lymphnode | 4.7 | ![]() |
Lymphoma_burkitts(Daudi) | 13.5 | ![]() |
Lymphoma_burkitts(Raji) | 7.65 | ![]() |
MedullaOblongata | 4.8 | ![]() |
OccipitalLobe | 4.9 | ![]() |
OlfactoryBulb | 5.65 | ![]() |
Ovary | 3.5 | ![]() |
Pancreas | 4.35 | ![]() |
PancreaticIslet | 5.85 | ![]() |
ParietalLobe | 5.75 | ![]() |
Pituitary | 6.35 | ![]() |
Placenta | 5.2 | ![]() |
Pons | 5.65 | ![]() |
PrefrontalCortex | 6.8 | ![]() |
Prostate | 6.3 | ![]() |
Salivarygland | 4.3 | ![]() |
SkeletalMuscle | 6.65 | ![]() |
Skin | 4.3 | ![]() |
SmoothMuscle | 6.1 | ![]() |
Spinalcord | 6.05 | ![]() |
SubthalamicNucleus | 4.9 | ![]() |
SuperiorCervicalGanglion | 7.65 | ![]() |
TemporalLobe | 4.95 | ![]() |
Testis | 4.7 | ![]() |
TestisGermCell | 4.3 | ![]() |
TestisIntersitial | 4.4 | ![]() |
TestisLeydigCell | 5.3 | ![]() |
TestisSeminiferousTubule | 4.5 | ![]() |
Thalamus | 5.55 | ![]() |
Thymus | 4.35 | ![]() |
Thyroid | 6.7 | ![]() |
Tongue | 6.25 | ![]() |
Tonsil | 5.3 | ![]() |
Trachea | 4.55 | ![]() |
TrigeminalGanglion | 6.8 | ![]() |
Uterus | 4.3 | ![]() |
UterusCorpus | 4.95 | ![]() |
WholeBlood | 61.2 | ![]() |
Wholebrain | 4.4 | ![]() |
colon | 5.25 | ![]() |
pineal_day | 6.62 | ![]() |
pineal_night | 6.6 | ![]() |
retina | 6.9 | ![]() |
small_intestine | 5.25 | ![]() |
- Probe name: A_23_P35412
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 6.52 ± 0.36 | ![]() ![]() ![]() |
Basal Forebrain | 6.6 ± 0.37 | ![]() ![]() ![]() |
Basal Part of Pons | 6.37 ± 0.26 | ![]() ![]() ![]() |
Cerebellar Cortex | 5.76 ± 0.28 | ![]() ![]() ![]() |
Cerebellar Nuclei | 6.16 ± 0.47 | ![]() ![]() ![]() |
Claustrum | 5.95 ± 0.7 | ![]() ![]() ![]() |
Epithalamus | 6.86 ± 0.37 | ![]() ![]() ![]() |
Frontal Lobe | 6.23 ± 0.54 | ![]() ![]() ![]() |
Globus Pallidus | 7.53 ± 0.25 | ![]() ![]() ![]() |
Hypothalamus | 6.77 ± 0.41 | ![]() ![]() ![]() |
Insula | 6.41 ± 0.43 | ![]() ![]() ![]() |
Limbic Lobe | 6.08 ± 0.54 | ![]() ![]() ![]() |
Mesencephalon | 6.45 ± 0.5 | ![]() ![]() ![]() |
Myelencephalon | 6.49 ± 0.61 | ![]() ![]() ![]() |
Occipital Lobe | 6.37 ± 0.49 | ![]() ![]() ![]() |
Parietal Lobe | 6.22 ± 0.47 | ![]() ![]() ![]() |
Pontine Tegmentum | 6.23 ± 0.69 | ![]() ![]() ![]() |
Striatum | 6.99 ± 0.4 | ![]() ![]() ![]() |
Subthalamus | 5.9 ± 0.16 | ![]() ![]() ![]() |
Temporal Lobe | 6.2 ± 0.5 | ![]() ![]() ![]() |
Thalamus | 6.58 ± 0.41 | ![]() ![]() ![]() |
White Matter | 6.82 ± 0.24 | ![]() ![]() ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00002977 | 33 | 325 | 357 | GLNPLNAYSDLAEFLETECYQTPFNKEVPDAEK | Peptide Atlas |