Annotation Detail for IREB2
Basic Information Top
| Gene Symbol: | IREB2 ( ACO3,FLJ23381,IRP2,IRP2AD ) |
|---|---|
| Gene Full Name: | iron-responsive element binding protein 2 |
| Band: | 15q25.1 |
| Quick Links | Entrez ID:3658; OMIM: 147582; Uniprot ID:IREB2_HUMAN; ENSEMBL ID: ENSG00000136381; HGNC ID: 6115 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.436031
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 4 / 70761 | 56 | |
| blastocyst | 9 / 62319 | 144 | |
| fetus | 54 / 564012 | 95 | |
| neonate | 0 / 31097 | 0 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 99 / 1939121 | 51 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 2 / 17475 | 114 | |
| breast (mammary gland) tumor | 2 / 94178 | 21 | |
| cervical tumor | 3 / 34366 | 87 | |
| chondrosarcoma | 4 / 82823 | 48 | |
| colorectal tumor | 4 / 114246 | 35 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 3 / 119369 | 25 | |
| germ cell tumor | 42 / 263845 | 159 | |
| glioma | 1 / 106883 | 9 | |
| head and neck tumor | 15 / 136302 | 110 | |
| kidney tumor | 1 / 68959 | 14 | |
| leukemia | 5 / 95842 | 52 | |
| liver tumor | 4 / 96359 | 41 | |
| lung tumor | 1 / 103127 | 9 | |
| lymphoma | 3 / 71755 | 41 | |
| non-neoplasia | 3 / 97250 | 30 | |
| normal | 179 / 3360307 | 53 | |
| ovarian tumor | 1 / 76682 | 13 | |
| pancreatic tumor | 1 / 104616 | 9 | |
| primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | |
| prostate cancer | 2 / 102680 | 19 | |
| retinoblastoma | 2 / 46356 | 43 | |
| skin tumor | 5 / 124949 | 40 | |
| soft tissue/muscle tissue tumor | 4 / 125191 | 31 | |
| uterine tumor | 3 / 90257 | 33 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 2 / 13106 | 152 | |
| adrenal gland | 1 / 33197 | 30 | |
| ascites | 1 / 40015 | 24 | |
| bladder | 5 / 29757 | 168 | |
| blood | 5 / 123478 | 40 | |
| bone | 3 / 71655 | 41 | |
| bone marrow | 5 / 48801 | 102 | |
| brain | 44 / 1100989 | 39 | |
| cervix | 3 / 48171 | 62 | |
| connective tissue | 5 / 149255 | 33 | |
| ear | 1 / 16212 | 61 | |
| embryonic tissue | 21 / 215722 | 97 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 6 / 211054 | 28 | |
| heart | 1 / 89626 | 11 | |
| intestine | 12 / 234472 | 51 | |
| kidney | 11 / 211777 | 51 | |
| larynx | 2 / 24145 | 82 | |
| liver | 8 / 207743 | 38 | |
| lung | 12 / 336974 | 35 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 7 / 91610 | 76 | |
| mammary gland | 4 / 153271 | 26 | |
| mouth | 9 / 67052 | 134 | |
| muscle | 4 / 107715 | 37 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 2 / 102051 | 19 | |
| pancreas | 12 / 214812 | 55 | |
| parathyroid | 1 / 20539 | 48 | |
| pharynx | 5 / 41328 | 120 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 17 / 280825 | 60 | |
| prostate | 2 / 189345 | 10 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 9 / 210574 | 42 | |
| spleen | 5 / 53952 | 92 | |
| stomach | 2 / 96619 | 20 | |
| testis | 43 / 330442 | 130 | |
| thymus | 12 / 81131 | 147 | |
| thyroid | 3 / 47473 | 63 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 4 / 52413 | 76 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 8 / 232878 | 34 | |
| vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 214666_x_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 13.45 | |
| Adipocyte | 11.5 | |
| AdrenalCortex | 17.05 | |
| Adrenalgland | 10.15 | |
| Amygdala | 11.75 | |
| Appendix | 17.7 | |
| AtrioventricularNode | 23 | |
| BDCA4+_DentriticCells | 12.6 | |
| Bonemarrow | 13.4 | |
| BronchialEpithelialCells | 11.25 | |
| CD105+_Endothelial | 12.2 | |
| CD14+_Monocytes | 24.85 | |
| CD19+_BCells(neg._sel.) | 12.45 | |
| CD33+_Myeloid | 14.8 | |
| CD34+ | 13.95 | |
| CD4+_Tcells | 12.6 | |
| CD56+_NKCells | 13.75 | |
| CD71+_EarlyErythroid | 11.4 | |
| CD8+_Tcells | 12.6 | |
| CardiacMyocytes | 20.5 | |
| Caudatenucleus | 9.7 | |
| Cerebellum | 9.35 | |
| CerebellumPeduncles | 16.3 | |
| CiliaryGanglion | 22.6 | |
| CingulateCortex | 12.15 | |
| Colorectaladenocarcinoma | 11.65 | |
| DorsalRootGanglion | 15.6 | |
| FetalThyroid | 12.4 | |
| Fetalbrain | 11.4 | |
| Fetalliver | 9.85 | |
| Fetallung | 9.5 | |
| GlobusPallidus | 10 | |
| Heart | 18.2 | |
| Hypothalamus | 12.1 | |
| Kidney | 10.35 | |
| Leukemia_chronicMyelogenousK-562 | 10.2 | |
| Leukemia_promyelocytic-HL-60 | 9.85 | |
| Leukemialymphoblastic(MOLT-4) | 9.3 | |
| Liver | 21.6 | |
| Lung | 12.35 | |
| Lymphnode | 9.3 | |
| Lymphoma_burkitts(Daudi) | 15 | |
| Lymphoma_burkitts(Raji) | 18.7 | |
| MedullaOblongata | 9.15 | |
| OccipitalLobe | 10.45 | |
| OlfactoryBulb | 9.1 | |
| Ovary | 12.35 | |
| Pancreas | 11.45 | |
| PancreaticIslet | 12.45 | |
| ParietalLobe | 13.1 | |
| Pituitary | 13.6 | |
| Placenta | 11.2 | |
| Pons | 11.3 | |
| PrefrontalCortex | 13.45 | |
| Prostate | 12.05 | |
| Salivarygland | 11.1 | |
| SkeletalMuscle | 25.6 | |
| Skin | 20.35 | |
| SmoothMuscle | 13.6 | |
| Spinalcord | 12.05 | |
| SubthalamicNucleus | 13.05 | |
| SuperiorCervicalGanglion | 29.5 | |
| TemporalLobe | 10.85 | |
| Testis | 9.45 | |
| TestisGermCell | 9.25 | |
| TestisIntersitial | 12.7 | |
| TestisLeydigCell | 14 | |
| TestisSeminiferousTubule | 10 | |
| Thalamus | 12.15 | |
| Thymus | 8.65 | |
| Thyroid | 12.45 | |
| Tongue | 20.95 | |
| Tonsil | 11.35 | |
| Trachea | 9.55 | |
| TrigeminalGanglion | 25.55 | |
| Uterus | 8.55 | |
| UterusCorpus | 13.05 | |
| WholeBlood | 12.8 | |
| Wholebrain | 8.5 | |
| colon | 11.75 | |
| pineal_day | 13.82 | |
| pineal_night | 14.74 | |
| retina | 13.9 | |
| small_intestine | 11.35 |
- Probe name: A_32_P421898
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 2.03 ± 1.02 | |
| Basal Forebrain | 1.57 ± 0.23 | |
| Basal Part of Pons | 1.28 ± 0.33 | |
| Cerebellar Cortex | 1.71 ± 0.78 | |
| Cerebellar Nuclei | 1.9 ± 0.74 | |
| Claustrum | 2.58 ± 0.85 | |
| Epithalamus | 1.3 ± 0.69 | |
| Frontal Lobe | 1.45 ± 0.65 | |
| Globus Pallidus | 2.07 ± 0.4 | |
| Hypothalamus | 1.72 ± 0.63 | |
| Insula | 1.65 ± 0.86 | |
| Limbic Lobe | 1.6 ± 0.62 | |
| Mesencephalon | 1.8 ± 0.58 | |
| Myelencephalon | 1.65 ± 0.69 | |
| Occipital Lobe | 1.82 ± 0.76 | |
| Parietal Lobe | 1.65 ± 0.68 | |
| Pontine Tegmentum | 1.64 ± 0.67 | |
| Striatum | 1.67 ± 0.49 | |
| Subthalamus | 1.75 ± 0.59 | |
| Temporal Lobe | 1.45 ± 0.56 | |
| Thalamus | 1.57 ± 0.57 | |
| White Matter | 2.05 ± 0.28 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Ireb2 | CB | Cerebellum | 0 | |
| 0 | ||||
| Ireb2 | CTX | Cerebral cortex | 0 | |
| 0 | ||||
| Ireb2 | HIP | Hippocampal region | 0 | |
| 0 | ||||
| Ireb2 | HPF | Hippocampal formation | 0 | |
| 0 | ||||
| Ireb2 | HY | Hypothalamus | 0 | |
| 0 | ||||
| Ireb2 | LSX | Lateral septal complex | 0 | |
| 0 | ||||
| Ireb2 | MB | Midbrain | 0 | |
| 0 | ||||
| Ireb2 | MY | Medulla | 0 | |
| 0 | ||||
| Ireb2 | OLF | Olfactory bulb | 0 | |
| 0 | ||||
| Ireb2 | P | Pons | 0 | |
| 0 | ||||
| Ireb2 | PAL | Pallidum | 0 | |
| 0 | ||||
| Ireb2 | RHP | Retrohippocampal region | 0 | |
| 0 | ||||
| Ireb2 | sAMY | Striatum-like amygdalar nuclei | 0 | |
| 0 | ||||
| Ireb2 | STR | Striatum | 0 | |
| 0 | ||||
| Ireb2 | STRd | Striatum dorsal region | 0 | |
| 0 | ||||
| Ireb2 | STRv | Striatum ventral region | 0 | |
| 0 | ||||
| Ireb2 | TH | Thalamus | 0 | |
| 0 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00005969 | 31 | 186 | 216 | NSGTFSSQIENTPILCPFHLQPVPEPETVLK | Peptide Atlas |



