Annotation Detail for IREB2


Gene Symbol: | IREB2 ( ACO3,FLJ23381,IRP2,IRP2AD ) |
---|---|
Gene Full Name: | iron-responsive element binding protein 2 |
Band: | 15q25.1 |
Quick Links | Entrez ID:3658; OMIM: 147582; Uniprot ID:IREB2_HUMAN; ENSEMBL ID: ENSG00000136381; HGNC ID: 6115 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.436031
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 4 / 70761 | 56 | ![]() |
blastocyst | 9 / 62319 | 144 | ![]() |
fetus | 54 / 564012 | 95 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 1 / 23620 | 42 | ![]() |
juvenile | 1 / 55556 | 17 | ![]() |
adult | 99 / 1939121 | 51 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 2 / 17475 | 114 | ![]() |
breast (mammary gland) tumor | 2 / 94178 | 21 | ![]() |
cervical tumor | 3 / 34366 | 87 | ![]() |
chondrosarcoma | 4 / 82823 | 48 | ![]() |
colorectal tumor | 4 / 114246 | 35 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 3 / 119369 | 25 | ![]() |
germ cell tumor | 42 / 263845 | 159 | ![]() |
glioma | 1 / 106883 | 9 | ![]() |
head and neck tumor | 15 / 136302 | 110 | ![]() |
kidney tumor | 1 / 68959 | 14 | ![]() |
leukemia | 5 / 95842 | 52 | ![]() |
liver tumor | 4 / 96359 | 41 | ![]() |
lung tumor | 1 / 103127 | 9 | ![]() |
lymphoma | 3 / 71755 | 41 | ![]() |
non-neoplasia | 3 / 97250 | 30 | ![]() |
normal | 179 / 3360307 | 53 | ![]() |
ovarian tumor | 1 / 76682 | 13 | ![]() |
pancreatic tumor | 1 / 104616 | 9 | ![]() |
primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | ![]() |
prostate cancer | 2 / 102680 | 19 | ![]() |
retinoblastoma | 2 / 46356 | 43 | ![]() |
skin tumor | 5 / 124949 | 40 | ![]() |
soft tissue/muscle tissue tumor | 4 / 125191 | 31 | ![]() |
uterine tumor | 3 / 90257 | 33 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 2 / 13106 | 152 | ![]() |
adrenal gland | 1 / 33197 | 30 | ![]() |
ascites | 1 / 40015 | 24 | ![]() |
bladder | 5 / 29757 | 168 | ![]() |
blood | 5 / 123478 | 40 | ![]() |
bone | 3 / 71655 | 41 | ![]() |
bone marrow | 5 / 48801 | 102 | ![]() |
brain | 44 / 1100989 | 39 | ![]() |
cervix | 3 / 48171 | 62 | ![]() |
connective tissue | 5 / 149255 | 33 | ![]() |
ear | 1 / 16212 | 61 | ![]() |
embryonic tissue | 21 / 215722 | 97 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 6 / 211054 | 28 | ![]() |
heart | 1 / 89626 | 11 | ![]() |
intestine | 12 / 234472 | 51 | ![]() |
kidney | 11 / 211777 | 51 | ![]() |
larynx | 2 / 24145 | 82 | ![]() |
liver | 8 / 207743 | 38 | ![]() |
lung | 12 / 336974 | 35 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 7 / 91610 | 76 | ![]() |
mammary gland | 4 / 153271 | 26 | ![]() |
mouth | 9 / 67052 | 134 | ![]() |
muscle | 4 / 107715 | 37 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 2 / 102051 | 19 | ![]() |
pancreas | 12 / 214812 | 55 | ![]() |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 5 / 41328 | 120 | ![]() |
pituitary gland | 0 / 16585 | 0 | |
placenta | 17 / 280825 | 60 | ![]() |
prostate | 2 / 189345 | 10 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 9 / 210574 | 42 | ![]() |
spleen | 5 / 53952 | 92 | ![]() |
stomach | 2 / 96619 | 20 | ![]() |
testis | 43 / 330442 | 130 | ![]() |
thymus | 12 / 81131 | 147 | ![]() |
thyroid | 3 / 47473 | 63 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 4 / 52413 | 76 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 8 / 232878 | 34 | ![]() |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 214666_x_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 13.45 | ![]() |
Adipocyte | 11.5 | ![]() |
AdrenalCortex | 17.05 | ![]() |
Adrenalgland | 10.15 | ![]() |
Amygdala | 11.75 | ![]() |
Appendix | 17.7 | ![]() |
AtrioventricularNode | 23 | ![]() |
BDCA4+_DentriticCells | 12.6 | ![]() |
Bonemarrow | 13.4 | ![]() |
BronchialEpithelialCells | 11.25 | ![]() |
CD105+_Endothelial | 12.2 | ![]() |
CD14+_Monocytes | 24.85 | ![]() |
CD19+_BCells(neg._sel.) | 12.45 | ![]() |
CD33+_Myeloid | 14.8 | ![]() |
CD34+ | 13.95 | ![]() |
CD4+_Tcells | 12.6 | ![]() |
CD56+_NKCells | 13.75 | ![]() |
CD71+_EarlyErythroid | 11.4 | ![]() |
CD8+_Tcells | 12.6 | ![]() |
CardiacMyocytes | 20.5 | ![]() |
Caudatenucleus | 9.7 | ![]() |
Cerebellum | 9.35 | ![]() |
CerebellumPeduncles | 16.3 | ![]() |
CiliaryGanglion | 22.6 | ![]() |
CingulateCortex | 12.15 | ![]() |
Colorectaladenocarcinoma | 11.65 | ![]() |
DorsalRootGanglion | 15.6 | ![]() |
FetalThyroid | 12.4 | ![]() |
Fetalbrain | 11.4 | ![]() |
Fetalliver | 9.85 | ![]() |
Fetallung | 9.5 | ![]() |
GlobusPallidus | 10 | ![]() |
Heart | 18.2 | ![]() |
Hypothalamus | 12.1 | ![]() |
Kidney | 10.35 | ![]() |
Leukemia_chronicMyelogenousK-562 | 10.2 | ![]() |
Leukemia_promyelocytic-HL-60 | 9.85 | ![]() |
Leukemialymphoblastic(MOLT-4) | 9.3 | ![]() |
Liver | 21.6 | ![]() |
Lung | 12.35 | ![]() |
Lymphnode | 9.3 | ![]() |
Lymphoma_burkitts(Daudi) | 15 | ![]() |
Lymphoma_burkitts(Raji) | 18.7 | ![]() |
MedullaOblongata | 9.15 | ![]() |
OccipitalLobe | 10.45 | ![]() |
OlfactoryBulb | 9.1 | ![]() |
Ovary | 12.35 | ![]() |
Pancreas | 11.45 | ![]() |
PancreaticIslet | 12.45 | ![]() |
ParietalLobe | 13.1 | ![]() |
Pituitary | 13.6 | ![]() |
Placenta | 11.2 | ![]() |
Pons | 11.3 | ![]() |
PrefrontalCortex | 13.45 | ![]() |
Prostate | 12.05 | ![]() |
Salivarygland | 11.1 | ![]() |
SkeletalMuscle | 25.6 | ![]() |
Skin | 20.35 | ![]() |
SmoothMuscle | 13.6 | ![]() |
Spinalcord | 12.05 | ![]() |
SubthalamicNucleus | 13.05 | ![]() |
SuperiorCervicalGanglion | 29.5 | ![]() |
TemporalLobe | 10.85 | ![]() |
Testis | 9.45 | ![]() |
TestisGermCell | 9.25 | ![]() |
TestisIntersitial | 12.7 | ![]() |
TestisLeydigCell | 14 | ![]() |
TestisSeminiferousTubule | 10 | ![]() |
Thalamus | 12.15 | ![]() |
Thymus | 8.65 | ![]() |
Thyroid | 12.45 | ![]() |
Tongue | 20.95 | ![]() |
Tonsil | 11.35 | ![]() |
Trachea | 9.55 | ![]() |
TrigeminalGanglion | 25.55 | ![]() |
Uterus | 8.55 | ![]() |
UterusCorpus | 13.05 | ![]() |
WholeBlood | 12.8 | ![]() |
Wholebrain | 8.5 | ![]() |
colon | 11.75 | ![]() |
pineal_day | 13.82 | ![]() |
pineal_night | 14.74 | ![]() |
retina | 13.9 | ![]() |
small_intestine | 11.35 | ![]() |
- Probe name: A_32_P421898
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 2.03 ± 1.02 | ![]() ![]() ![]() |
Basal Forebrain | 1.57 ± 0.23 | ![]() ![]() ![]() |
Basal Part of Pons | 1.28 ± 0.33 | ![]() ![]() ![]() |
Cerebellar Cortex | 1.71 ± 0.78 | ![]() ![]() ![]() |
Cerebellar Nuclei | 1.9 ± 0.74 | ![]() ![]() ![]() |
Claustrum | 2.58 ± 0.85 | ![]() ![]() ![]() |
Epithalamus | 1.3 ± 0.69 | ![]() ![]() ![]() |
Frontal Lobe | 1.45 ± 0.65 | ![]() ![]() ![]() |
Globus Pallidus | 2.07 ± 0.4 | ![]() ![]() ![]() |
Hypothalamus | 1.72 ± 0.63 | ![]() ![]() ![]() |
Insula | 1.65 ± 0.86 | ![]() ![]() ![]() |
Limbic Lobe | 1.6 ± 0.62 | ![]() ![]() ![]() |
Mesencephalon | 1.8 ± 0.58 | ![]() ![]() ![]() |
Myelencephalon | 1.65 ± 0.69 | ![]() ![]() ![]() |
Occipital Lobe | 1.82 ± 0.76 | ![]() ![]() ![]() |
Parietal Lobe | 1.65 ± 0.68 | ![]() ![]() ![]() |
Pontine Tegmentum | 1.64 ± 0.67 | ![]() ![]() ![]() |
Striatum | 1.67 ± 0.49 | ![]() ![]() ![]() |
Subthalamus | 1.75 ± 0.59 | ![]() ![]() ![]() |
Temporal Lobe | 1.45 ± 0.56 | ![]() ![]() ![]() |
Thalamus | 1.57 ± 0.57 | ![]() ![]() ![]() |
White Matter | 2.05 ± 0.28 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Ireb2 | CB | Cerebellum | 0 | ![]() |
0 | ![]() | |||
Ireb2 | CTX | Cerebral cortex | 0 | ![]() |
0 | ![]() | |||
Ireb2 | HIP | Hippocampal region | 0 | ![]() |
0 | ![]() | |||
Ireb2 | HPF | Hippocampal formation | 0 | ![]() |
0 | ![]() | |||
Ireb2 | HY | Hypothalamus | 0 | ![]() |
0 | ![]() | |||
Ireb2 | LSX | Lateral septal complex | 0 | ![]() |
0 | ![]() | |||
Ireb2 | MB | Midbrain | 0 | ![]() |
0 | ![]() | |||
Ireb2 | MY | Medulla | 0 | ![]() |
0 | ![]() | |||
Ireb2 | OLF | Olfactory bulb | 0 | ![]() |
0 | ![]() | |||
Ireb2 | P | Pons | 0 | ![]() |
0 | ![]() | |||
Ireb2 | PAL | Pallidum | 0 | ![]() |
0 | ![]() | |||
Ireb2 | RHP | Retrohippocampal region | 0 | ![]() |
0 | ![]() | |||
Ireb2 | sAMY | Striatum-like amygdalar nuclei | 0 | ![]() |
0 | ![]() | |||
Ireb2 | STR | Striatum | 0 | ![]() |
0 | ![]() | |||
Ireb2 | STRd | Striatum dorsal region | 0 | ![]() |
0 | ![]() | |||
Ireb2 | STRv | Striatum ventral region | 0 | ![]() |
0 | ![]() | |||
Ireb2 | TH | Thalamus | 0 | ![]() |
0 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00005969 | 31 | 186 | 216 | NSGTFSSQIENTPILCPFHLQPVPEPETVLK | Peptide Atlas |