Annotation Detail for ITGAL
Basic Information Top
Gene Symbol: | ITGAL ( CD11A,LFA-1,LFA1A ) |
---|---|
Gene Full Name: | integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) |
Band: | 16p11.2 |
Quick Links | Entrez ID:3683; OMIM: 153370; Uniprot ID:ITAL_HUMAN; ENSEMBL ID: ENSG00000005844; HGNC ID: 6148 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.174103
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 4 / 564012 | 7 | |
neonate | 2 / 31097 | 64 | |
infant | 0 / 23620 | 0 | |
juvenile | 2 / 55556 | 35 | |
adult | 53 / 1939121 | 27 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 1 / 114246 | 8 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 1 / 119369 | 8 | |
germ cell tumor | 2 / 263845 | 7 | |
glioma | 1 / 106883 | 9 | |
head and neck tumor | 5 / 136302 | 36 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 16 / 95842 | 166 | |
liver tumor | 1 / 96359 | 10 | |
lung tumor | 2 / 103127 | 19 | |
lymphoma | 6 / 71755 | 83 | |
non-neoplasia | 0 / 97250 | 0 | |
normal | 108 / 3360307 | 32 | |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 2 / 90257 | 22 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 1 / 33197 | 30 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 21 / 123478 | 170 | |
bone | 0 / 71655 | 0 | |
bone marrow | 12 / 48801 | 245 | |
brain | 8 / 1100989 | 7 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 0 / 149255 | 0 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 0 / 20209 | 0 | |
eye | 1 / 211054 | 4 | |
heart | 0 / 89626 | 0 | |
intestine | 1 / 234472 | 4 | |
kidney | 1 / 211777 | 4 | |
larynx | 0 / 24145 | 0 | |
liver | 2 / 207743 | 9 | |
lung | 6 / 336974 | 17 | |
lymph | 5 / 44270 | 112 | |
lymph node | 34 / 91610 | 371 | |
mammary gland | 2 / 153271 | 13 | |
mouth | 3 / 67052 | 44 | |
muscle | 5 / 107715 | 46 | |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 2 / 41328 | 48 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 3 / 280825 | 10 | |
prostate | 1 / 189345 | 5 | |
salivary gland | 0 / 20155 | 0 | |
skin | 0 / 210574 | 0 | |
spleen | 24 / 53952 | 444 | |
stomach | 5 / 96619 | 51 | |
testis | 5 / 330442 | 15 | |
thymus | 47 / 81131 | 579 | |
thyroid | 2 / 47473 | 42 | |
tonsil | 0 / 16999 | 0 | |
trachea | 6 / 52413 | 114 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 7 / 232878 | 30 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 213475_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 47.45 | |
Adipocyte | 35.4 | |
AdrenalCortex | 64.3 | |
Adrenalgland | 33.7 | |
Amygdala | 20.9 | |
Appendix | 34.25 | |
AtrioventricularNode | 49.9 | |
BDCA4+_DentriticCells | 132.95 | |
Bonemarrow | 57.7 | |
BronchialEpithelialCells | 28.85 | |
CD105+_Endothelial | 37.7 | |
CD14+_Monocytes | 204.9 | |
CD19+_BCells(neg._sel.) | 85.65 | |
CD33+_Myeloid | 423.45 | |
CD34+ | 98.3 | |
CD4+_Tcells | 394.8 | |
CD56+_NKCells | 829.3 | |
CD71+_EarlyErythroid | 37.55 | |
CD8+_Tcells | 551.7 | |
CardiacMyocytes | 80.65 | |
Caudatenucleus | 32.05 | |
Cerebellum | 27.75 | |
CerebellumPeduncles | 73.4 | |
CiliaryGanglion | 59.1 | |
CingulateCortex | 40.8 | |
Colorectaladenocarcinoma | 32.1 | |
DorsalRootGanglion | 35.2 | |
FetalThyroid | 40.1 | |
Fetalbrain | 30.95 | |
Fetalliver | 30.5 | |
Fetallung | 21 | |
GlobusPallidus | 36.1 | |
Heart | 74.85 | |
Hypothalamus | 31.05 | |
Kidney | 36.7 | |
Leukemia_chronicMyelogenousK-562 | 30.6 | |
Leukemia_promyelocytic-HL-60 | 29.95 | |
Leukemialymphoblastic(MOLT-4) | 54.15 | |
Liver | 61.85 | |
Lung | 50.6 | |
Lymphnode | 159.05 | |
Lymphoma_burkitts(Daudi) | 65.1 | |
Lymphoma_burkitts(Raji) | 93.4 | |
MedullaOblongata | 27.5 | |
OccipitalLobe | 37.7 | |
OlfactoryBulb | 26.25 | |
Ovary | 35.9 | |
Pancreas | 36.1 | |
PancreaticIslet | 38.45 | |
ParietalLobe | 44.8 | |
Pituitary | 52.75 | |
Placenta | 33 | |
Pons | 41.3 | |
PrefrontalCortex | 31.75 | |
Prostate | 32.2 | |
Salivarygland | 38.85 | |
SkeletalMuscle | 71.1 | |
Skin | 26.75 | |
SmoothMuscle | 45.25 | |
Spinalcord | 40.15 | |
SubthalamicNucleus | 42 | |
SuperiorCervicalGanglion | 40.4 | |
TemporalLobe | 37.7 | |
Testis | 28.9 | |
TestisGermCell | 26.05 | |
TestisIntersitial | 34.85 | |
TestisLeydigCell | 46.25 | |
TestisSeminiferousTubule | 33.55 | |
Thalamus | 42.45 | |
Thymus | 69.85 | |
Thyroid | 27.3 | |
Tongue | 61.05 | |
Tonsil | 104.25 | |
Trachea | 29.45 | |
TrigeminalGanglion | 43.65 | |
Uterus | 19.7 | |
UterusCorpus | 34.35 | |
WholeBlood | 200.35 | |
Wholebrain | 19.75 | |
colon | 30.75 | |
pineal_day | 32.64 | |
pineal_night | 32.54 | |
retina | 41.6 | |
small_intestine | 30.4 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_23_P206806
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 2.86 ± 1.07 | |
Basal Forebrain | 2.32 ± 0.38 | |
Basal Part of Pons | 2.46 ± 0.88 | |
Cerebellar Cortex | 2.1 ± 0.65 | |
Cerebellar Nuclei | 2.87 ± 0.73 | |
Claustrum | 3.31 ± 0.82 | |
Epithalamus | 2.78 ± 1 | |
Frontal Lobe | 2.29 ± 0.78 | |
Globus Pallidus | 4.19 ± 0.44 | |
Hypothalamus | 2.46 ± 0.97 | |
Insula | 2.63 ± 0.86 | |
Limbic Lobe | 2.39 ± 0.86 | |
Mesencephalon | 2.56 ± 0.79 | |
Myelencephalon | 2.57 ± 0.79 | |
Occipital Lobe | 2.34 ± 0.68 | |
Parietal Lobe | 2.49 ± 0.84 | |
Pontine Tegmentum | 2.4 ± 0.77 | |
Striatum | 2.7 ± 0.75 | |
Subthalamus | 2.9 ± 0.97 | |
Temporal Lobe | 2.43 ± 0.81 | |
Thalamus | 2.35 ± 0.69 | |
White Matter | 3.91 ± 0.31 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Itgal | CB | Cerebellum | 6.34 | |
8.34 | ||||
Itgal | CTX | Cerebral cortex | 4.5 | |
3.45 | ||||
Itgal | HIP | Hippocampal region | 2.9 | |
4.57 | ||||
Itgal | HPF | Hippocampal formation | 2.11 | |
3.04 | ||||
Itgal | HY | Hypothalamus | 1.77 | |
2.11 | ||||
Itgal | LSX | Lateral septal complex | 2 | |
1.77 | ||||
Itgal | MB | Midbrain | 1.49 | |
2.16 | ||||
Itgal | MY | Medulla | 1.51 | |
1.68 | ||||
Itgal | OLF | Olfactory bulb | 6.05 | |
5.26 | ||||
Itgal | P | Pons | 1.11 | |
1.56 | ||||
Itgal | PAL | Pallidum | 3.78 | |
3.44 | ||||
Itgal | RHP | Retrohippocampal region | 0.77 | |
0.9 | ||||
Itgal | sAMY | Striatum-like amygdalar nuclei | 1.02 | |
0.93 | ||||
Itgal | STR | Striatum | 3.9 | |
3.56 | ||||
Itgal | STRd | Striatum dorsal region | 4.45 | |
4.18 | ||||
Itgal | STRv | Striatum ventral region | 4.54 | |
3.83 | ||||
Itgal | TH | Thalamus | 2.51 | |
2.52 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
ITAL_HUMAN_225 | 21 | 225 | 245 | HMLLLTNTFGAINYVATEVFR | PRIDE |
ITAL_HUMAN_225 | 32 | 225 | 256 | HMLLLTNTFGAINYVATEVFREELGARPDATK | PRIDE |
ITAL_HUMAN_400 | 14 | 400 | 413 | AGYLGYTVTWLPSR | PRIDE |
ITAL_HUMAN_416 | 10 | 416 | 425 | TSLLASGAPR | PRIDE |
ITAL_HUMAN_568 | 15 | 568 | 582 | IEGTQVLSGIQWFGR | PRIDE |
ITAL_HUMAN_748 | 21 | 748 | 768 | DIPPILRPSLHSETWEIPFEK | PRIDE |
PAp00011625 | 16 | 118 | 133 | TCDQNTYLSGLCYLFR | Peptide Atlas |