Annotation Detail for ITGAL
Basic Information Top
| Gene Symbol: | ITGAL ( CD11A,LFA-1,LFA1A ) |
|---|---|
| Gene Full Name: | integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) |
| Band: | 16p11.2 |
| Quick Links | Entrez ID:3683; OMIM: 153370; Uniprot ID:ITAL_HUMAN; ENSEMBL ID: ENSG00000005844; HGNC ID: 6148 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.174103
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 0 / 70761 | 0 | |
| blastocyst | 0 / 62319 | 0 | |
| fetus | 4 / 564012 | 7 | |
| neonate | 2 / 31097 | 64 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 2 / 55556 | 35 | |
| adult | 53 / 1939121 | 27 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 0 / 94178 | 0 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 0 / 82823 | 0 | |
| colorectal tumor | 1 / 114246 | 8 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 1 / 119369 | 8 | |
| germ cell tumor | 2 / 263845 | 7 | |
| glioma | 1 / 106883 | 9 | |
| head and neck tumor | 5 / 136302 | 36 | |
| kidney tumor | 0 / 68959 | 0 | |
| leukemia | 16 / 95842 | 166 | |
| liver tumor | 1 / 96359 | 10 | |
| lung tumor | 2 / 103127 | 19 | |
| lymphoma | 6 / 71755 | 83 | |
| non-neoplasia | 0 / 97250 | 0 | |
| normal | 108 / 3360307 | 32 | |
| ovarian tumor | 0 / 76682 | 0 | |
| pancreatic tumor | 0 / 104616 | 0 | |
| primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
| prostate cancer | 0 / 102680 | 0 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
| uterine tumor | 2 / 90257 | 22 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 1 / 33197 | 30 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 0 / 29757 | 0 | |
| blood | 21 / 123478 | 170 | |
| bone | 0 / 71655 | 0 | |
| bone marrow | 12 / 48801 | 245 | |
| brain | 8 / 1100989 | 7 | |
| cervix | 0 / 48171 | 0 | |
| connective tissue | 0 / 149255 | 0 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 0 / 215722 | 0 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 1 / 211054 | 4 | |
| heart | 0 / 89626 | 0 | |
| intestine | 1 / 234472 | 4 | |
| kidney | 1 / 211777 | 4 | |
| larynx | 0 / 24145 | 0 | |
| liver | 2 / 207743 | 9 | |
| lung | 6 / 336974 | 17 | |
| lymph | 5 / 44270 | 112 | |
| lymph node | 34 / 91610 | 371 | |
| mammary gland | 2 / 153271 | 13 | |
| mouth | 3 / 67052 | 44 | |
| muscle | 5 / 107715 | 46 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 0 / 102051 | 0 | |
| pancreas | 0 / 214812 | 0 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 2 / 41328 | 48 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 3 / 280825 | 10 | |
| prostate | 1 / 189345 | 5 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 0 / 210574 | 0 | |
| spleen | 24 / 53952 | 444 | |
| stomach | 5 / 96619 | 51 | |
| testis | 5 / 330442 | 15 | |
| thymus | 47 / 81131 | 579 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 6 / 52413 | 114 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 7 / 232878 | 30 | |
| vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 213475_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 47.45 | |
| Adipocyte | 35.4 | |
| AdrenalCortex | 64.3 | |
| Adrenalgland | 33.7 | |
| Amygdala | 20.9 | |
| Appendix | 34.25 | |
| AtrioventricularNode | 49.9 | |
| BDCA4+_DentriticCells | 132.95 | |
| Bonemarrow | 57.7 | |
| BronchialEpithelialCells | 28.85 | |
| CD105+_Endothelial | 37.7 | |
| CD14+_Monocytes | 204.9 | |
| CD19+_BCells(neg._sel.) | 85.65 | |
| CD33+_Myeloid | 423.45 | |
| CD34+ | 98.3 | |
| CD4+_Tcells | 394.8 | |
| CD56+_NKCells | 829.3 | |
| CD71+_EarlyErythroid | 37.55 | |
| CD8+_Tcells | 551.7 | |
| CardiacMyocytes | 80.65 | |
| Caudatenucleus | 32.05 | |
| Cerebellum | 27.75 | |
| CerebellumPeduncles | 73.4 | |
| CiliaryGanglion | 59.1 | |
| CingulateCortex | 40.8 | |
| Colorectaladenocarcinoma | 32.1 | |
| DorsalRootGanglion | 35.2 | |
| FetalThyroid | 40.1 | |
| Fetalbrain | 30.95 | |
| Fetalliver | 30.5 | |
| Fetallung | 21 | |
| GlobusPallidus | 36.1 | |
| Heart | 74.85 | |
| Hypothalamus | 31.05 | |
| Kidney | 36.7 | |
| Leukemia_chronicMyelogenousK-562 | 30.6 | |
| Leukemia_promyelocytic-HL-60 | 29.95 | |
| Leukemialymphoblastic(MOLT-4) | 54.15 | |
| Liver | 61.85 | |
| Lung | 50.6 | |
| Lymphnode | 159.05 | |
| Lymphoma_burkitts(Daudi) | 65.1 | |
| Lymphoma_burkitts(Raji) | 93.4 | |
| MedullaOblongata | 27.5 | |
| OccipitalLobe | 37.7 | |
| OlfactoryBulb | 26.25 | |
| Ovary | 35.9 | |
| Pancreas | 36.1 | |
| PancreaticIslet | 38.45 | |
| ParietalLobe | 44.8 | |
| Pituitary | 52.75 | |
| Placenta | 33 | |
| Pons | 41.3 | |
| PrefrontalCortex | 31.75 | |
| Prostate | 32.2 | |
| Salivarygland | 38.85 | |
| SkeletalMuscle | 71.1 | |
| Skin | 26.75 | |
| SmoothMuscle | 45.25 | |
| Spinalcord | 40.15 | |
| SubthalamicNucleus | 42 | |
| SuperiorCervicalGanglion | 40.4 | |
| TemporalLobe | 37.7 | |
| Testis | 28.9 | |
| TestisGermCell | 26.05 | |
| TestisIntersitial | 34.85 | |
| TestisLeydigCell | 46.25 | |
| TestisSeminiferousTubule | 33.55 | |
| Thalamus | 42.45 | |
| Thymus | 69.85 | |
| Thyroid | 27.3 | |
| Tongue | 61.05 | |
| Tonsil | 104.25 | |
| Trachea | 29.45 | |
| TrigeminalGanglion | 43.65 | |
| Uterus | 19.7 | |
| UterusCorpus | 34.35 | |
| WholeBlood | 200.35 | |
| Wholebrain | 19.75 | |
| colon | 30.75 | |
| pineal_day | 32.64 | |
| pineal_night | 32.54 | |
| retina | 41.6 | |
| small_intestine | 30.4 |
- Probe name: A_23_P206806
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 2.86 ± 1.07 | |
| Basal Forebrain | 2.32 ± 0.38 | |
| Basal Part of Pons | 2.46 ± 0.88 | |
| Cerebellar Cortex | 2.1 ± 0.65 | |
| Cerebellar Nuclei | 2.87 ± 0.73 | |
| Claustrum | 3.31 ± 0.82 | |
| Epithalamus | 2.78 ± 1 | |
| Frontal Lobe | 2.29 ± 0.78 | |
| Globus Pallidus | 4.19 ± 0.44 | |
| Hypothalamus | 2.46 ± 0.97 | |
| Insula | 2.63 ± 0.86 | |
| Limbic Lobe | 2.39 ± 0.86 | |
| Mesencephalon | 2.56 ± 0.79 | |
| Myelencephalon | 2.57 ± 0.79 | |
| Occipital Lobe | 2.34 ± 0.68 | |
| Parietal Lobe | 2.49 ± 0.84 | |
| Pontine Tegmentum | 2.4 ± 0.77 | |
| Striatum | 2.7 ± 0.75 | |
| Subthalamus | 2.9 ± 0.97 | |
| Temporal Lobe | 2.43 ± 0.81 | |
| Thalamus | 2.35 ± 0.69 | |
| White Matter | 3.91 ± 0.31 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Itgal | CB | Cerebellum | 6.34 | |
| 8.34 | ||||
| Itgal | CTX | Cerebral cortex | 4.5 | |
| 3.45 | ||||
| Itgal | HIP | Hippocampal region | 2.9 | |
| 4.57 | ||||
| Itgal | HPF | Hippocampal formation | 2.11 | |
| 3.04 | ||||
| Itgal | HY | Hypothalamus | 1.77 | |
| 2.11 | ||||
| Itgal | LSX | Lateral septal complex | 2 | |
| 1.77 | ||||
| Itgal | MB | Midbrain | 1.49 | |
| 2.16 | ||||
| Itgal | MY | Medulla | 1.51 | |
| 1.68 | ||||
| Itgal | OLF | Olfactory bulb | 6.05 | |
| 5.26 | ||||
| Itgal | P | Pons | 1.11 | |
| 1.56 | ||||
| Itgal | PAL | Pallidum | 3.78 | |
| 3.44 | ||||
| Itgal | RHP | Retrohippocampal region | 0.77 | |
| 0.9 | ||||
| Itgal | sAMY | Striatum-like amygdalar nuclei | 1.02 | |
| 0.93 | ||||
| Itgal | STR | Striatum | 3.9 | |
| 3.56 | ||||
| Itgal | STRd | Striatum dorsal region | 4.45 | |
| 4.18 | ||||
| Itgal | STRv | Striatum ventral region | 4.54 | |
| 3.83 | ||||
| Itgal | TH | Thalamus | 2.51 | |
| 2.52 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| ITAL_HUMAN_225 | 21 | 225 | 245 | HMLLLTNTFGAINYVATEVFR | PRIDE |
| ITAL_HUMAN_225 | 32 | 225 | 256 | HMLLLTNTFGAINYVATEVFREELGARPDATK | PRIDE |
| ITAL_HUMAN_400 | 14 | 400 | 413 | AGYLGYTVTWLPSR | PRIDE |
| ITAL_HUMAN_416 | 10 | 416 | 425 | TSLLASGAPR | PRIDE |
| ITAL_HUMAN_568 | 15 | 568 | 582 | IEGTQVLSGIQWFGR | PRIDE |
| ITAL_HUMAN_748 | 21 | 748 | 768 | DIPPILRPSLHSETWEIPFEK | PRIDE |
| PAp00011625 | 16 | 118 | 133 | TCDQNTYLSGLCYLFR | Peptide Atlas |



