Annotation Detail for ITGAX
Basic Information Top
Gene Symbol: | ITGAX ( CD11C,SLEB6 ) |
---|---|
Gene Full Name: | integrin, alpha X (complement component 3 receptor 4 subunit) |
Band: | 16p11.2 |
Quick Links | Entrez ID:3687; OMIM: 151510; Uniprot ID:ITAX_HUMAN; ENSEMBL ID: ENSG00000140678; HGNC ID: 6152 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.248472
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 2 / 564012 | 3 | |
neonate | 6 / 31097 | 192 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 25 / 1939121 | 12 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 1 / 82823 | 12 | |
colorectal tumor | 1 / 114246 | 8 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 3 / 119369 | 25 | |
germ cell tumor | 8 / 263845 | 30 | |
glioma | 1 / 106883 | 9 | |
head and neck tumor | 2 / 136302 | 14 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 5 / 95842 | 52 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 4 / 97250 | 41 | |
normal | 50 / 3360307 | 14 | |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 1 / 90257 | 11 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 1 / 29757 | 33 | |
blood | 17 / 123478 | 137 | |
bone | 0 / 71655 | 0 | |
bone marrow | 7 / 48801 | 143 | |
brain | 18 / 1100989 | 16 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 2 / 149255 | 13 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 0 / 20209 | 0 | |
eye | 2 / 211054 | 9 | |
heart | 0 / 89626 | 0 | |
intestine | 2 / 234472 | 8 | |
kidney | 1 / 211777 | 4 | |
larynx | 2 / 24145 | 82 | |
liver | 0 / 207743 | 0 | |
lung | 7 / 336974 | 20 | |
lymph | 0 / 44270 | 0 | |
lymph node | 7 / 91610 | 76 | |
mammary gland | 0 / 153271 | 0 | |
mouth | 0 / 67052 | 0 | |
muscle | 0 / 107715 | 0 | |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 1 / 41328 | 24 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 0 / 280825 | 0 | |
prostate | 2 / 189345 | 10 | |
salivary gland | 1 / 20155 | 49 | |
skin | 0 / 210574 | 0 | |
spleen | 3 / 53952 | 55 | |
stomach | 3 / 96619 | 31 | |
testis | 1 / 330442 | 3 | |
thymus | 1 / 81131 | 12 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 2 / 232878 | 8 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 210184_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 5.75 | |
Adipocyte | 4.5 | |
AdrenalCortex | 4.7 | |
Adrenalgland | 3.8 | |
Amygdala | 4.85 | |
Appendix | 4.45 | |
AtrioventricularNode | 3.4 | |
BDCA4+_DentriticCells | 9.5 | |
Bonemarrow | 4.5 | |
BronchialEpithelialCells | 4.4 | |
CD105+_Endothelial | 4.55 | |
CD14+_Monocytes | 57.25 | |
CD19+_BCells(neg._sel.) | 4.85 | |
CD33+_Myeloid | 32.85 | |
CD34+ | 5.85 | |
CD4+_Tcells | 4.9 | |
CD56+_NKCells | 45.3 | |
CD71+_EarlyErythroid | 4.2 | |
CD8+_Tcells | 4.2 | |
CardiacMyocytes | 5.4 | |
Caudatenucleus | 4.1 | |
Cerebellum | 3.85 | |
CerebellumPeduncles | 5.35 | |
CiliaryGanglion | 3.1 | |
CingulateCortex | 4.6 | |
Colorectaladenocarcinoma | 4.5 | |
DorsalRootGanglion | 3.45 | |
FetalThyroid | 4.35 | |
Fetalbrain | 4.5 | |
Fetalliver | 3.9 | |
Fetallung | 3.8 | |
GlobusPallidus | 3.25 | |
Heart | 5.65 | |
Hypothalamus | 5.4 | |
Kidney | 3.6 | |
Leukemia_chronicMyelogenousK-562 | 4.05 | |
Leukemia_promyelocytic-HL-60 | 4.05 | |
Leukemialymphoblastic(MOLT-4) | 3.6 | |
Liver | 6.35 | |
Lung | 7.45 | |
Lymphnode | 24.35 | |
Lymphoma_burkitts(Daudi) | 5.75 | |
Lymphoma_burkitts(Raji) | 7.4 | |
MedullaOblongata | 4.45 | |
OccipitalLobe | 4.1 | |
OlfactoryBulb | 3.6 | |
Ovary | 2.95 | |
Pancreas | 3.6 | |
PancreaticIslet | 4.85 | |
ParietalLobe | 4.7 | |
Pituitary | 5.35 | |
Placenta | 4.6 | |
Pons | 5 | |
PrefrontalCortex | 5.65 | |
Prostate | 5 | |
Salivarygland | 3.8 | |
SkeletalMuscle | 5.2 | |
Skin | 3.4 | |
SmoothMuscle | 4.85 | |
Spinalcord | 7.3 | |
SubthalamicNucleus | 4.1 | |
SuperiorCervicalGanglion | 5 | |
TemporalLobe | 4.1 | |
Testis | 3.95 | |
TestisGermCell | 3.75 | |
TestisIntersitial | 3.65 | |
TestisLeydigCell | 4.45 | |
TestisSeminiferousTubule | 3.85 | |
Thalamus | 4.65 | |
Thymus | 3.35 | |
Thyroid | 5.35 | |
Tongue | 4.35 | |
Tonsil | 6.75 | |
Trachea | 3.75 | |
TrigeminalGanglion | 4.4 | |
Uterus | 3.65 | |
UterusCorpus | 4.3 | |
WholeBlood | 51.15 | |
Wholebrain | 3.8 | |
colon | 4.55 | |
pineal_day | 5.62 | |
pineal_night | 6 | |
retina | 5.5 | |
small_intestine | 4.35 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_23_P312132
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.76 ± 0.7 | |
Basal Forebrain | 3.71 ± 1.07 | |
Basal Part of Pons | 4.86 ± 0.59 | |
Cerebellar Cortex | 3.21 ± 0.66 | |
Cerebellar Nuclei | 5.59 ± 0.59 | |
Claustrum | 3.57 ± 0.94 | |
Epithalamus | 4.92 ± 0.61 | |
Frontal Lobe | 3.68 ± 0.75 | |
Globus Pallidus | 5.73 ± 0.52 | |
Hypothalamus | 3.88 ± 1.24 | |
Insula | 3.78 ± 0.63 | |
Limbic Lobe | 3.49 ± 0.7 | |
Mesencephalon | 3.73 ± 0.89 | |
Myelencephalon | 3.79 ± 0.95 | |
Occipital Lobe | 3.19 ± 1.01 | |
Parietal Lobe | 3.74 ± 0.73 | |
Pontine Tegmentum | 3.57 ± 0.63 | |
Striatum | 4.21 ± 0.61 | |
Subthalamus | 4.71 ± 0.81 | |
Temporal Lobe | 4.03 ± 0.77 | |
Thalamus | 3.85 ± 0.66 | |
White Matter | 5.92 ± 0.48 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Itgax | CB | Cerebellum | 5.11 | |
7.38 | ||||
Itgax | CTX | Cerebral cortex | 4.96 | |
5 | ||||
Itgax | HIP | Hippocampal region | 2.26 | |
2.95 | ||||
Itgax | HPF | Hippocampal formation | 2.16 | |
2.58 | ||||
Itgax | HY | Hypothalamus | 1.7 | |
1.86 | ||||
Itgax | LSX | Lateral septal complex | 1.41 | |
0.99 | ||||
Itgax | MB | Midbrain | 3.21 | |
3.61 | ||||
Itgax | MY | Medulla | 13.36 | |
13.19 | ||||
Itgax | OLF | Olfactory bulb | 9.43 | |
7.14 | ||||
Itgax | P | Pons | 4.51 | |
4.62 | ||||
Itgax | PAL | Pallidum | 2.52 | |
2.13 | ||||
Itgax | RHP | Retrohippocampal region | 1.97 | |
1.87 | ||||
Itgax | sAMY | Striatum-like amygdalar nuclei | 1.99 | |
1.92 | ||||
Itgax | STR | Striatum | 2.3 | |
2.26 | ||||
Itgax | STRd | Striatum dorsal region | 1.52 | |
1.64 | ||||
Itgax | STRv | Striatum ventral region | 5.41 | |
4.65 | ||||
Itgax | TH | Thalamus | 3.67 | |
4.75 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
ITAX_HUMAN_0 | 0 | 0 | 0 | AVIFTQVSR | PRIDE |
ITAX_HUMAN_0 | 0 | 0 | 0 | GAVYLFHGVLGPSISPSHSQR | PRIDE |
ITAX_HUMAN_0 | 0 | 0 | 0 | GGQVSVCPLPR | PRIDE |
ITAX_HUMAN_0 | 0 | 0 | 0 | GVQSLVLGAPR | PRIDE |
ITAX_HUMAN_0 | 0 | 0 | 0 | SSNPLSLLASVHQLQGFTYTATAIQNVVHR | PRIDE |
ITAX_HUMAN_0 | 0 | 0 | 0 | TTFQLELPVK | PRIDE |
ITAX_HUMAN_0 | 0 | 0 | 0 | YFTASLPFEK | PRIDE |
PAp00492319 | 11 | 489 | 499 | GGQVSVCPLPR | Peptide Atlas |