Annotation Detail for JUP
Basic Information Top
Gene Symbol: | JUP ( ARVD12,CTNNG,DP3,DPIII,PDGB,PKGB ) |
---|---|
Gene Full Name: | junction plakoglobin |
Band: | 17q21.2 |
Quick Links | Entrez ID:3728; OMIM: 173325; Uniprot ID:PLAK_HUMAN; ENSEMBL ID: ENSG00000173801; HGNC ID: 6207 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.514174
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 30 / 70761 | 423 | |
blastocyst | 14 / 62319 | 224 | |
fetus | 18 / 564012 | 31 | |
neonate | 0 / 31097 | 0 | |
infant | 1 / 23620 | 42 | |
juvenile | 0 / 55556 | 0 | |
adult | 258 / 1939121 | 133 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 10 / 17475 | 572 | |
breast (mammary gland) tumor | 26 / 94178 | 276 | |
cervical tumor | 2 / 34366 | 58 | |
chondrosarcoma | 5 / 82823 | 60 | |
colorectal tumor | 36 / 114246 | 315 | |
esophageal tumor | 4 / 17290 | 231 | |
gastrointestinal tumor | 24 / 119369 | 201 | |
germ cell tumor | 39 / 263845 | 147 | |
glioma | 25 / 106883 | 233 | |
head and neck tumor | 33 / 136302 | 242 | |
kidney tumor | 3 / 68959 | 43 | |
leukemia | 6 / 95842 | 62 | |
liver tumor | 1 / 96359 | 10 | |
lung tumor | 11 / 103127 | 106 | |
lymphoma | 7 / 71755 | 97 | |
non-neoplasia | 9 / 97250 | 92 | |
normal | 207 / 3360307 | 61 | |
ovarian tumor | 15 / 76682 | 195 | |
pancreatic tumor | 75 / 104616 | 716 | |
primitive neuroectodermal tumor of the CNS | 21 / 125680 | 167 | |
prostate cancer | 15 / 102680 | 146 | |
retinoblastoma | 6 / 46356 | 129 | |
skin tumor | 9 / 124949 | 72 | |
soft tissue/muscle tissue tumor | 7 / 125191 | 55 | |
uterine tumor | 17 / 90257 | 188 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 1 / 13106 | 76 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 10 / 40015 | 249 | |
bladder | 10 / 29757 | 336 | |
blood | 3 / 123478 | 24 | |
bone | 1 / 71655 | 13 | |
bone marrow | 1 / 48801 | 20 | |
brain | 50 / 1100989 | 45 | |
cervix | 8 / 48171 | 166 | |
connective tissue | 1 / 149255 | 6 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 49 / 215722 | 227 | |
esophagus | 4 / 20209 | 197 | |
eye | 21 / 211054 | 99 | |
heart | 3 / 89626 | 33 | |
intestine | 54 / 234472 | 230 | |
kidney | 12 / 211777 | 56 | |
larynx | 14 / 24145 | 579 | |
liver | 3 / 207743 | 14 | |
lung | 32 / 336974 | 94 | |
lymph | 1 / 44270 | 22 | |
lymph node | 11 / 91610 | 120 | |
mammary gland | 38 / 153271 | 247 | |
mouth | 12 / 67052 | 178 | |
muscle | 2 / 107715 | 18 | |
nerve | 2 / 15768 | 126 | |
ovary | 20 / 102051 | 195 | |
pancreas | 77 / 214812 | 358 | |
parathyroid | 2 / 20539 | 97 | |
pharynx | 7 / 41328 | 169 | |
pituitary gland | 2 / 16585 | 120 | |
placenta | 37 / 280825 | 131 | |
prostate | 21 / 189345 | 110 | |
salivary gland | 0 / 20155 | 0 | |
skin | 38 / 210574 | 180 | |
spleen | 0 / 53952 | 0 | |
stomach | 12 / 96619 | 124 | |
testis | 3 / 330442 | 9 | |
thymus | 1 / 81131 | 12 | |
thyroid | 6 / 47473 | 126 | |
tonsil | 1 / 16999 | 58 | |
trachea | 1 / 52413 | 19 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 31 / 232878 | 133 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201015_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 365.15 | |
Adipocyte | 10.9 | |
AdrenalCortex | 15.5 | |
Adrenalgland | 25.75 | |
Amygdala | 20.25 | |
Appendix | 18.7 | |
AtrioventricularNode | 25.8 | |
BDCA4+_DentriticCells | 74.05 | |
Bonemarrow | 14.6 | |
BronchialEpithelialCells | 1086.65 | |
CD105+_Endothelial | 24.75 | |
CD14+_Monocytes | 57.4 | |
CD19+_BCells(neg._sel.) | 97.9 | |
CD33+_Myeloid | 32.7 | |
CD34+ | 116.05 | |
CD4+_Tcells | 11.1 | |
CD56+_NKCells | 18.45 | |
CD71+_EarlyErythroid | 9.1 | |
CD8+_Tcells | 8.9 | |
CardiacMyocytes | 68.05 | |
Caudatenucleus | 14.95 | |
Cerebellum | 34.75 | |
CerebellumPeduncles | 45.85 | |
CiliaryGanglion | 9.55 | |
CingulateCortex | 29.85 | |
Colorectaladenocarcinoma | 249.9 | |
DorsalRootGanglion | 20 | |
FetalThyroid | 141.3 | |
Fetalbrain | 62.85 | |
Fetalliver | 24.35 | |
Fetallung | 226.75 | |
GlobusPallidus | 12.25 | |
Heart | 549.35 | |
Hypothalamus | 14.6 | |
Kidney | 311.7 | |
Leukemia_chronicMyelogenousK-562 | 213.8 | |
Leukemia_promyelocytic-HL-60 | 16.25 | |
Leukemialymphoblastic(MOLT-4) | 12.95 | |
Liver | 372.5 | |
Lung | 290.75 | |
Lymphnode | 40.05 | |
Lymphoma_burkitts(Daudi) | 18.85 | |
Lymphoma_burkitts(Raji) | 39.3 | |
MedullaOblongata | 17.65 | |
OccipitalLobe | 18 | |
OlfactoryBulb | 29.4 | |
Ovary | 17.2 | |
Pancreas | 166.1 | |
PancreaticIslet | 54.8 | |
ParietalLobe | 17.35 | |
Pituitary | 75.8 | |
Placenta | 760.05 | |
Pons | 14.45 | |
PrefrontalCortex | 38 | |
Prostate | 374.45 | |
Salivarygland | 35 | |
SkeletalMuscle | 36 | |
Skin | 227.85 | |
SmoothMuscle | 83.5 | |
Spinalcord | 33.4 | |
SubthalamicNucleus | 18.55 | |
SuperiorCervicalGanglion | 29.55 | |
TemporalLobe | 13.5 | |
Testis | 26.4 | |
TestisGermCell | 22.8 | |
TestisIntersitial | 16 | |
TestisLeydigCell | 25.5 | |
TestisSeminiferousTubule | 21.2 | |
Thalamus | 14.7 | |
Thymus | 91.25 | |
Thyroid | 939.5 | |
Tongue | 1788.05 | |
Tonsil | 507.4 | |
Trachea | 356.7 | |
TrigeminalGanglion | 23.1 | |
Uterus | 54.55 | |
UterusCorpus | 22.3 | |
WholeBlood | 20.95 | |
Wholebrain | 14.8 | |
colon | 188.25 | |
pineal_day | 23.58 | |
pineal_night | 34.5 | |
retina | 78.425 | |
small_intestine | 90.5 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: CUST_14028_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.01 ± 0.92 | |
Basal Forebrain | 2.52 ± 0.37 | |
Basal Part of Pons | 2.31 ± 0.54 | |
Cerebellar Cortex | 3.21 ± 0.52 | |
Cerebellar Nuclei | 2.99 ± 0.76 | |
Claustrum | 3.24 ± 0.81 | |
Epithalamus | 2.28 ± 0.68 | |
Frontal Lobe | 2.56 ± 0.82 | |
Globus Pallidus | 3.08 ± 0.78 | |
Hypothalamus | 2.47 ± 0.62 | |
Insula | 2.69 ± 0.55 | |
Limbic Lobe | 2.51 ± 0.75 | |
Mesencephalon | 2.77 ± 0.84 | |
Myelencephalon | 2.59 ± 0.74 | |
Occipital Lobe | 2.42 ± 0.78 | |
Parietal Lobe | 2.28 ± 0.76 | |
Pontine Tegmentum | 2.64 ± 0.75 | |
Striatum | 2.48 ± 0.81 | |
Subthalamus | 2.61 ± 0.72 | |
Temporal Lobe | 2.46 ± 0.74 | |
Thalamus | 2.53 ± 0.68 | |
White Matter | 4.53 ± 0.42 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Jup | CB | Cerebellum | 82.68 | |
82.01 | ||||
Jup | CTX | Cerebral cortex | 21.97 | |
17.54 | ||||
Jup | HIP | Hippocampal region | 9.33 | |
9.99 | ||||
Jup | HPF | Hippocampal formation | 9.57 | |
9.32 | ||||
Jup | HY | Hypothalamus | 4.53 | |
3.41 | ||||
Jup | LSX | Lateral septal complex | 3.75 | |
3.81 | ||||
Jup | MB | Midbrain | 7.67 | |
6.47 | ||||
Jup | MY | Medulla | 17.55 | |
20.45 | ||||
Jup | OLF | Olfactory bulb | 41.69 | |
40.73 | ||||
Jup | P | Pons | 13.81 | |
14.15 | ||||
Jup | PAL | Pallidum | 9.38 | |
7.18 | ||||
Jup | RHP | Retrohippocampal region | 9.86 | |
8.32 | ||||
Jup | sAMY | Striatum-like amygdalar nuclei | 7.68 | |
6.26 | ||||
Jup | STR | Striatum | 19.01 | |
14.9 | ||||
Jup | STRd | Striatum dorsal region | 21.86 | |
17.53 | ||||
Jup | STRv | Striatum ventral region | 20.22 | |
13.84 | ||||
Jup | TH | Thalamus | 29.35 | |
25.94 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00000341 | 16 | 445 | 460 | AGDKDDITEPAVCALR | Peptide Atlas |
PLAK_HUMAN_149 | 12 | 149 | 160 | LLNDEDPVVVTK | PRIDE |
PLAK_HUMAN_177 | 14 | 177 | 190 | ALMGSPQLVAAVVR | PRIDE |
PLAK_HUMAN_425 | 18 | 425 | 442 | TLVTQNSGVEALIHAILR | PRIDE |
PLAK_HUMAN_505 | 20 | 505 | 524 | NLALCPANHAPLQEAAVIPR | PRIDE |
PLAK_HUMAN_581 | 20 | 581 | 600 | LNTIPLFVQLLYSSVENIQR | PRIDE |
PLAK_HUMAN_601 | 35 | 601 | 635 | VAAGVLCELAQDKEAADAIDAEGASAPLMELLHSR | PRIDE |