Annotation Detail for LPL
Basic Information Top
| Gene Symbol: | LPL ( HDLCQ11,LIPD ) |
|---|---|
| Gene Full Name: | lipoprotein lipase |
| Band: | 8p21.3 |
| Quick Links | Entrez ID:4023; OMIM: 609708; Uniprot ID:LIPL_HUMAN; ENSEMBL ID: ENSG00000175445; HGNC ID: 6677 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.180878
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
 | |||
| embryoid body | 0 / 70761 | 0 | |
| blastocyst | 0 / 62319 | 0 | |
| fetus | 366 / 564012 | 648 |  |
| neonate | 2 / 31097 | 64 |  |
| infant | 1 / 23620 | 42 |  |
| juvenile | 7 / 55556 | 125 | |
| adult | 150 / 1939121 | 77 | |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
| |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 3 / 94178 | 31 | |
| cervical tumor | 5 / 34366 | 145 | |
| chondrosarcoma | 6 / 82823 | 72 | |
| colorectal tumor | 2 / 114246 | 17 | |
| esophageal tumor | 2 / 17290 | 115 | |
| gastrointestinal tumor | 2 / 119369 | 16 | |
| germ cell tumor | 6 / 263845 | 22 | |
| glioma | 6 / 106883 | 56 | |
| head and neck tumor | 3 / 136302 | 22 | |
| kidney tumor | 4 / 68959 | 58 | |
| leukemia | 0 / 95842 | 0 | |
| liver tumor | 0 / 96359 | 0 | |
| lung tumor | 0 / 103127 | 0 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 7 / 97250 | 71 | |
| normal | 957 / 3360307 | 284 | |
| ovarian tumor | 3 / 76682 | 39 | |
| pancreatic tumor | 0 / 104616 | 0 | |
| primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 |  |
| prostate cancer | 0 / 102680 | 0 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
| uterine tumor | 1 / 90257 | 11 | |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
| |||
| adipose tissue | 49 / 13106 | 3738 |  |
| adrenal gland | 3 / 33197 | 90 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 0 / 29757 | 0 | |
| blood | 2 / 123478 | 16 | |
| bone | 1 / 71655 | 13 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 600 / 1100989 | 544 | |
| cervix | 5 / 48171 | 103 | |
| connective tissue | 9 / 149255 | 60 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 2 / 215722 | 9 | |
| esophagus | 2 / 20209 | 98 | |
| eye | 15 / 211054 | 71 | |
| heart | 101 / 89626 | 1126 | |
| intestine | 11 / 234472 | 46 | |
| kidney | 27 / 211777 | 127 | |
| larynx | 1 / 24145 | 41 | |
| liver | 2 / 207743 | 9 | |
| lung | 81 / 336974 | 240 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 15 / 153271 | 97 | |
| mouth | 14 / 67052 | 208 | |
| muscle | 11 / 107715 | 102 | |
| nerve | 9 / 15768 | 570 | |
| ovary | 4 / 102051 | 39 | |
| pancreas | 10 / 214812 | 46 | |
| parathyroid | 42 / 20539 | 2044 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 26 / 280825 | 92 | |
| prostate | 9 / 189345 | 47 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 0 / 210574 | 0 | |
| spleen | 4 / 53952 | 74 | |
| stomach | 3 / 96619 | 31 | |
| testis | 11 / 330442 | 33 | |
| thymus | 18 / 81131 | 221 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 29 / 52413 | 553 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 5 / 232878 | 21 | |
| vascular | 1 / 51780 | 19 | |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 203548_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
| ||
| 721_B_lymphoblasts | 4.95 | |
| Adipocyte | 2482.95 | |
| AdrenalCortex | 4.25 | |
| Adrenalgland | 5.85 | |
| Amygdala | 4.25 | |
| Appendix | 9.8 | |
| AtrioventricularNode | 54.8 | |
| BDCA4+_DentriticCells | 4.45 | |
| Bonemarrow | 4 | |
| BronchialEpithelialCells | 3.85 | |
| CD105+_Endothelial | 23.4 | |
| CD14+_Monocytes | 4.25 | |
| CD19+_BCells(neg._sel.) | 4.2 | |
| CD33+_Myeloid | 5.05 | |
| CD34+ | 5.05 | |
| CD4+_Tcells | 4.2 | |
| CD56+_NKCells | 4.75 | |
| CD71+_EarlyErythroid | 3.75 | |
| CD8+_Tcells | 3.75 | |
| CardiacMyocytes | 5.3 | |
| Caudatenucleus | 96 | |
| Cerebellum | 8.95 | |
| CerebellumPeduncles | 6.6 | |
| CiliaryGanglion | 293.35 | |
| CingulateCortex | 4.3 | |
| Colorectaladenocarcinoma | 4.1 | |
| DorsalRootGanglion | 451.5 | |
| FetalThyroid | 5.9 | |
| Fetalbrain | 125.5 | |
| Fetalliver | 3.45 | |
| Fetallung | 24.85 | |
| GlobusPallidus | 2.95 | |
| Heart | 31.9 | |
| Hypothalamus | 4.45 | |
| Kidney | 3.3 | |
| Leukemia_chronicMyelogenousK-562 | 3.6 | |
| Leukemia_promyelocytic-HL-60 | 3.55 | |
| Leukemialymphoblastic(MOLT-4) | 3.2 | |
| Liver | 5.35 | |
| Lung | 22.25 | |
| Lymphnode | 3.9 | |
| Lymphoma_burkitts(Daudi) | 5.15 | |
| Lymphoma_burkitts(Raji) | 5.7 | |
| MedullaOblongata | 19.75 | |
| OccipitalLobe | 3.65 | |
| OlfactoryBulb | 929.85 | |
| Ovary | 2.8 | |
| Pancreas | 3.2 | |
| PancreaticIslet | 4.4 | |
| ParietalLobe | 4.3 | |
| Pituitary | 4.65 | |
| Placenta | 98.4 | |
| Pons | 15.85 | |
| PrefrontalCortex | 6.55 | |
| Prostate | 4.75 | |
| Salivarygland | 3.2 | |
| SkeletalMuscle | 5.85 | |
| Skin | 3.25 | |
| SmoothMuscle | 4.4 | |
| Spinalcord | 6.5 | |
| SubthalamicNucleus | 4.05 | |
| SuperiorCervicalGanglion | 6.55 | |
| TemporalLobe | 3.75 | |
| Testis | 3.4 | |
| TestisGermCell | 3.35 | |
| TestisIntersitial | 3.4 | |
| TestisLeydigCell | 4 | |
| TestisSeminiferousTubule | 3.4 | |
| Thalamus | 4.1 | |
| Thymus | 11.65 | |
| Thyroid | 5.65 | |
| Tongue | 5.25 | |
| Tonsil | 3.9 | |
| Trachea | 4.7 | |
| TrigeminalGanglion | 64.8 | |
| Uterus | 3.25 | |
| UterusCorpus | 3.65 | |
| WholeBlood | 4.35 | |
| Wholebrain | 3.35 | |
| colon | 15.05 | |
| pineal_day | 5.22 | |
| pineal_night | 5.14 | |
| retina | 10.325 | |
| small_intestine | 4.1 | |
- Probe name: CUST_16283_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 5.31 ± 0.97 | ![](../"images/bar_3.png"){kind=small}   |
| Basal Forebrain | 6.53 ± 0.69 | |
| Basal Part of Pons | 5.07 ± 0.66 | |
| Cerebellar Cortex | 5.8 ± 0.48 | |
| Cerebellar Nuclei | 6.11 ± 0.39 | |
| Claustrum | 4.15 ± 0.39 | |
| Epithalamus | 4.87 ± 1.33 | |
| Frontal Lobe | 5.06 ± 0.74 | |
| Globus Pallidus | 5.3 ± 1.3 | |
| Hypothalamus | 6 ± 1.35 | |
| Insula | 5.27 ± 0.4 | |
| Limbic Lobe | 5.77 ± 1.3 | |
| Mesencephalon | 5.24 ± 0.95 | |
| Myelencephalon | 5.46 ± 0.87 | |
| Occipital Lobe | 5.26 ± 1.14 | |
| Parietal Lobe | 5.77 ± 1.05 | |
| Pontine Tegmentum | 5.69 ± 1.02 | |
| Striatum | 8.81 ± 1.58 | |
| Subthalamus | 5.37 ± 0.82 | |
| Temporal Lobe | 5.44 ± 0.62 | |
| Thalamus | 5.19 ± 0.92 | |
| White Matter | 4.68 ± 0.33 | |
Mouse Brain ISH 
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Lpl | CB | Cerebellum | 0.78 | |
| 1.33 | | |||
| Lpl | CTX | Cerebral cortex | 4.5 | |
| 3.81 | | |||
| Lpl | HIP | Hippocampal region | 34.46 | |
| 58.79 | | |||
| Lpl | HPF | Hippocampal formation | 22.34 | |
| 34.6 | | |||
| Lpl | HY | Hypothalamus | 0.79 | |
| 1.09 | | |||
| Lpl | LSX | Lateral septal complex | 1.13 | |
| 1.4 | | |||
| Lpl | MB | Midbrain | 1.1 | |
| 1.74 | | |||
| Lpl | MY | Medulla | 0.84 | |
| 0.9 | | |||
| Lpl | OLF | Olfactory bulb | 9.83 | |
| 10.4 | | |||
| Lpl | P | Pons | 0.43 | |
| 0.47 | | |||
| Lpl | PAL | Pallidum | 1.13 | |
| 0.96 | | |||
| Lpl | RHP | Retrohippocampal region | 5.54 | |
| 6.96 | | |||
| Lpl | sAMY | Striatum-like amygdalar nuclei | 2.52 | |
| 2.23 | | |||
| Lpl | STR | Striatum | 21.99 | |
| 15.36 | | |||
| Lpl | STRd | Striatum dorsal region | 26.41 | |
| 18.23 | | |||
| Lpl | STRv | Striatum ventral region | 26.9 | |
| 18.6 | | |||
| Lpl | TH | Thalamus | 0.49 | |
| 0.41 | |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00474120 | 31 | 220 | 250 | SIGIQKPVGHVDIYPNGGTFQPGCNIGEAIR | Peptide Atlas |