Annotation Detail for MMP15
Basic Information Top
| Gene Symbol: | MMP15 ( MT2-MMP,MTMMP2,SMCP-2 ) |
|---|---|
| Gene Full Name: | matrix metallopeptidase 15 (membrane-inserted) |
| Band: | 16q21 |
| Quick Links | Entrez ID:4324; OMIM: 602261; Uniprot ID:MMP15_HUMAN; ENSEMBL ID: ENSG00000102996; HGNC ID: 7161 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.80343
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 5 / 70761 | 70 | |
| blastocyst | 7 / 62319 | 112 | |
| fetus | 21 / 564012 | 37 | |
| neonate | 0 / 31097 | 0 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 2 / 55556 | 35 | |
| adult | 60 / 1939121 | 30 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 0 / 94178 | 0 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 2 / 82823 | 24 | |
| colorectal tumor | 4 / 114246 | 35 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 18 / 119369 | 150 | |
| germ cell tumor | 8 / 263845 | 30 | |
| glioma | 1 / 106883 | 9 | |
| head and neck tumor | 3 / 136302 | 22 | |
| kidney tumor | 3 / 68959 | 43 | |
| leukemia | 2 / 95842 | 20 | |
| liver tumor | 3 / 96359 | 31 | |
| lung tumor | 2 / 103127 | 19 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 2 / 97250 | 20 | |
| normal | 88 / 3360307 | 26 | |
| ovarian tumor | 2 / 76682 | 26 | |
| pancreatic tumor | 13 / 104616 | 124 | |
| primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
| prostate cancer | 10 / 102680 | 97 | |
| retinoblastoma | 1 / 46356 | 21 | |
| skin tumor | 2 / 124949 | 16 | |
| soft tissue/muscle tissue tumor | 4 / 125191 | 31 | |
| uterine tumor | 6 / 90257 | 66 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 1 / 33197 | 30 | |
| ascites | 8 / 40015 | 199 | |
| bladder | 0 / 29757 | 0 | |
| blood | 1 / 123478 | 8 | |
| bone | 1 / 71655 | 13 | |
| bone marrow | 0 / 48801 | 0 | |
| brain | 8 / 1100989 | 7 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 2 / 149255 | 13 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 14 / 215722 | 64 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 3 / 211054 | 14 | |
| heart | 4 / 89626 | 44 | |
| intestine | 7 / 234472 | 29 | |
| kidney | 3 / 211777 | 14 | |
| larynx | 0 / 24145 | 0 | |
| liver | 3 / 207743 | 14 | |
| lung | 15 / 336974 | 44 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 4 / 153271 | 26 | |
| mouth | 0 / 67052 | 0 | |
| muscle | 5 / 107715 | 46 | |
| nerve | 3 / 15768 | 190 | |
| ovary | 2 / 102051 | 19 | |
| pancreas | 13 / 214812 | 60 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 12 / 280825 | 42 | |
| prostate | 11 / 189345 | 58 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 2 / 210574 | 9 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 12 / 96619 | 124 | |
| testis | 11 / 330442 | 33 | |
| thymus | 0 / 81131 | 0 | |
| thyroid | 3 / 47473 | 63 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 7 / 232878 | 30 | |
| vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 203365_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 5.4 | |
| Adipocyte | 4.35 | |
| AdrenalCortex | 4.55 | |
| Adrenalgland | 3.7 | |
| Amygdala | 4.6 | |
| Appendix | 4.45 | |
| AtrioventricularNode | 3.35 | |
| BDCA4+_DentriticCells | 8.25 | |
| Bonemarrow | 4.35 | |
| BronchialEpithelialCells | 4.4 | |
| CD105+_Endothelial | 4.25 | |
| CD14+_Monocytes | 4.5 | |
| CD19+_BCells(neg._sel.) | 4.55 | |
| CD33+_Myeloid | 5.45 | |
| CD34+ | 5.65 | |
| CD4+_Tcells | 4.9 | |
| CD56+_NKCells | 5.3 | |
| CD71+_EarlyErythroid | 4.2 | |
| CD8+_Tcells | 4.1 | |
| CardiacMyocytes | 5.6 | |
| Caudatenucleus | 3.95 | |
| Cerebellum | 3.55 | |
| CerebellumPeduncles | 5 | |
| CiliaryGanglion | 3.1 | |
| CingulateCortex | 5.35 | |
| Colorectaladenocarcinoma | 5 | |
| DorsalRootGanglion | 3.35 | |
| FetalThyroid | 39 | |
| Fetalbrain | 4.45 | |
| Fetalliver | 3.8 | |
| Fetallung | 6.75 | |
| GlobusPallidus | 3.25 | |
| Heart | 16.55 | |
| Hypothalamus | 4.8 | |
| Kidney | 3.55 | |
| Leukemia_chronicMyelogenousK-562 | 4 | |
| Leukemia_promyelocytic-HL-60 | 3.9 | |
| Leukemialymphoblastic(MOLT-4) | 3.6 | |
| Liver | 12.2 | |
| Lung | 4.95 | |
| Lymphnode | 3.85 | |
| Lymphoma_burkitts(Daudi) | 5.55 | |
| Lymphoma_burkitts(Raji) | 6.2 | |
| MedullaOblongata | 3.75 | |
| OccipitalLobe | 4 | |
| OlfactoryBulb | 7.95 | |
| Ovary | 2.95 | |
| Pancreas | 4.15 | |
| PancreaticIslet | 4.7 | |
| ParietalLobe | 4.65 | |
| Pituitary | 5.2 | |
| Placenta | 32.6 | |
| Pons | 4.2 | |
| PrefrontalCortex | 5.55 | |
| Prostate | 5.2 | |
| Salivarygland | 3.5 | |
| SkeletalMuscle | 5.05 | |
| Skin | 3.4 | |
| SmoothMuscle | 4.9 | |
| Spinalcord | 4.9 | |
| SubthalamicNucleus | 4 | |
| SuperiorCervicalGanglion | 5.05 | |
| TemporalLobe | 4.35 | |
| Testis | 9.95 | |
| TestisGermCell | 41.65 | |
| TestisIntersitial | 4.4 | |
| TestisLeydigCell | 4.95 | |
| TestisSeminiferousTubule | 7.15 | |
| Thalamus | 7.45 | |
| Thymus | 3.4 | |
| Thyroid | 79.3 | |
| Tongue | 4.3 | |
| Tonsil | 4.35 | |
| Trachea | 3.55 | |
| TrigeminalGanglion | 4.35 | |
| Uterus | 3.45 | |
| UterusCorpus | 3.9 | |
| WholeBlood | 4.6 | |
| Wholebrain | 3.7 | |
| colon | 4.5 | |
| pineal_day | 5.48 | |
| pineal_night | 5.42 | |
| retina | 5.425 | |
| small_intestine | 4.35 |
- Probe name: A_23_P100177
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 2.1 ± 0.98 | |
| Basal Forebrain | 1.61 ± 0.21 | |
| Basal Part of Pons | 1.82 ± 0.75 | |
| Cerebellar Cortex | 1.79 ± 0.83 | |
| Cerebellar Nuclei | 2 ± 0.67 | |
| Claustrum | 2.47 ± 0.71 | |
| Epithalamus | 1.4 ± 0.73 | |
| Frontal Lobe | 1.7 ± 0.68 | |
| Globus Pallidus | 2.16 ± 0.3 | |
| Hypothalamus | 1.72 ± 0.57 | |
| Insula | 1.61 ± 0.34 | |
| Limbic Lobe | 1.71 ± 0.58 | |
| Mesencephalon | 1.88 ± 0.72 | |
| Myelencephalon | 1.83 ± 0.61 | |
| Occipital Lobe | 1.82 ± 0.53 | |
| Parietal Lobe | 1.81 ± 0.82 | |
| Pontine Tegmentum | 1.71 ± 0.62 | |
| Striatum | 1.76 ± 0.47 | |
| Subthalamus | 1.92 ± 0.67 | |
| Temporal Lobe | 1.67 ± 0.62 | |
| Thalamus | 2.03 ± 0.61 | |
| White Matter | 2.23 ± 0.4 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00501489 | 39 | 569 | 607 | WPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNK | Peptide Atlas |




Mouse Brain ISH