Annotation Detail for MMP15


Gene Symbol: | MMP15 ( MT2-MMP,MTMMP2,SMCP-2 ) |
---|---|
Gene Full Name: | matrix metallopeptidase 15 (membrane-inserted) |
Band: | 16q21 |
Quick Links | Entrez ID:4324; OMIM: 602261; Uniprot ID:MMP15_HUMAN; ENSEMBL ID: ENSG00000102996; HGNC ID: 7161 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.80343
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 5 / 70761 | 70 | ![]() |
blastocyst | 7 / 62319 | 112 | ![]() |
fetus | 21 / 564012 | 37 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 2 / 55556 | 35 | ![]() |
adult | 60 / 1939121 | 30 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 2 / 82823 | 24 | ![]() |
colorectal tumor | 4 / 114246 | 35 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 18 / 119369 | 150 | ![]() |
germ cell tumor | 8 / 263845 | 30 | ![]() |
glioma | 1 / 106883 | 9 | ![]() |
head and neck tumor | 3 / 136302 | 22 | ![]() |
kidney tumor | 3 / 68959 | 43 | ![]() |
leukemia | 2 / 95842 | 20 | ![]() |
liver tumor | 3 / 96359 | 31 | ![]() |
lung tumor | 2 / 103127 | 19 | ![]() |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 2 / 97250 | 20 | ![]() |
normal | 88 / 3360307 | 26 | ![]() |
ovarian tumor | 2 / 76682 | 26 | ![]() |
pancreatic tumor | 13 / 104616 | 124 | ![]() |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 10 / 102680 | 97 | ![]() |
retinoblastoma | 1 / 46356 | 21 | ![]() |
skin tumor | 2 / 124949 | 16 | ![]() |
soft tissue/muscle tissue tumor | 4 / 125191 | 31 | ![]() |
uterine tumor | 6 / 90257 | 66 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 1 / 33197 | 30 | ![]() |
ascites | 8 / 40015 | 199 | ![]() |
bladder | 0 / 29757 | 0 | |
blood | 1 / 123478 | 8 | ![]() |
bone | 1 / 71655 | 13 | ![]() |
bone marrow | 0 / 48801 | 0 | |
brain | 8 / 1100989 | 7 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 2 / 149255 | 13 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 14 / 215722 | 64 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 3 / 211054 | 14 | ![]() |
heart | 4 / 89626 | 44 | ![]() |
intestine | 7 / 234472 | 29 | ![]() |
kidney | 3 / 211777 | 14 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 3 / 207743 | 14 | ![]() |
lung | 15 / 336974 | 44 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 4 / 153271 | 26 | ![]() |
mouth | 0 / 67052 | 0 | |
muscle | 5 / 107715 | 46 | ![]() |
nerve | 3 / 15768 | 190 | ![]() |
ovary | 2 / 102051 | 19 | ![]() |
pancreas | 13 / 214812 | 60 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 12 / 280825 | 42 | ![]() |
prostate | 11 / 189345 | 58 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 2 / 210574 | 9 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 12 / 96619 | 124 | ![]() |
testis | 11 / 330442 | 33 | ![]() |
thymus | 0 / 81131 | 0 | |
thyroid | 3 / 47473 | 63 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 7 / 232878 | 30 | ![]() |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 203365_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 5.4 | ![]() |
Adipocyte | 4.35 | ![]() |
AdrenalCortex | 4.55 | ![]() |
Adrenalgland | 3.7 | ![]() |
Amygdala | 4.6 | ![]() |
Appendix | 4.45 | ![]() |
AtrioventricularNode | 3.35 | ![]() |
BDCA4+_DentriticCells | 8.25 | ![]() |
Bonemarrow | 4.35 | ![]() |
BronchialEpithelialCells | 4.4 | ![]() |
CD105+_Endothelial | 4.25 | ![]() |
CD14+_Monocytes | 4.5 | ![]() |
CD19+_BCells(neg._sel.) | 4.55 | ![]() |
CD33+_Myeloid | 5.45 | ![]() |
CD34+ | 5.65 | ![]() |
CD4+_Tcells | 4.9 | ![]() |
CD56+_NKCells | 5.3 | ![]() |
CD71+_EarlyErythroid | 4.2 | ![]() |
CD8+_Tcells | 4.1 | ![]() |
CardiacMyocytes | 5.6 | ![]() |
Caudatenucleus | 3.95 | ![]() |
Cerebellum | 3.55 | ![]() |
CerebellumPeduncles | 5 | ![]() |
CiliaryGanglion | 3.1 | ![]() |
CingulateCortex | 5.35 | ![]() |
Colorectaladenocarcinoma | 5 | ![]() |
DorsalRootGanglion | 3.35 | ![]() |
FetalThyroid | 39 | ![]() |
Fetalbrain | 4.45 | ![]() |
Fetalliver | 3.8 | ![]() |
Fetallung | 6.75 | ![]() |
GlobusPallidus | 3.25 | ![]() |
Heart | 16.55 | ![]() |
Hypothalamus | 4.8 | ![]() |
Kidney | 3.55 | ![]() |
Leukemia_chronicMyelogenousK-562 | 4 | ![]() |
Leukemia_promyelocytic-HL-60 | 3.9 | ![]() |
Leukemialymphoblastic(MOLT-4) | 3.6 | ![]() |
Liver | 12.2 | ![]() |
Lung | 4.95 | ![]() |
Lymphnode | 3.85 | ![]() |
Lymphoma_burkitts(Daudi) | 5.55 | ![]() |
Lymphoma_burkitts(Raji) | 6.2 | ![]() |
MedullaOblongata | 3.75 | ![]() |
OccipitalLobe | 4 | ![]() |
OlfactoryBulb | 7.95 | ![]() |
Ovary | 2.95 | ![]() |
Pancreas | 4.15 | ![]() |
PancreaticIslet | 4.7 | ![]() |
ParietalLobe | 4.65 | ![]() |
Pituitary | 5.2 | ![]() |
Placenta | 32.6 | ![]() |
Pons | 4.2 | ![]() |
PrefrontalCortex | 5.55 | ![]() |
Prostate | 5.2 | ![]() |
Salivarygland | 3.5 | ![]() |
SkeletalMuscle | 5.05 | ![]() |
Skin | 3.4 | ![]() |
SmoothMuscle | 4.9 | ![]() |
Spinalcord | 4.9 | ![]() |
SubthalamicNucleus | 4 | ![]() |
SuperiorCervicalGanglion | 5.05 | ![]() |
TemporalLobe | 4.35 | ![]() |
Testis | 9.95 | ![]() |
TestisGermCell | 41.65 | ![]() |
TestisIntersitial | 4.4 | ![]() |
TestisLeydigCell | 4.95 | ![]() |
TestisSeminiferousTubule | 7.15 | ![]() |
Thalamus | 7.45 | ![]() |
Thymus | 3.4 | ![]() |
Thyroid | 79.3 | ![]() |
Tongue | 4.3 | ![]() |
Tonsil | 4.35 | ![]() |
Trachea | 3.55 | ![]() |
TrigeminalGanglion | 4.35 | ![]() |
Uterus | 3.45 | ![]() |
UterusCorpus | 3.9 | ![]() |
WholeBlood | 4.6 | ![]() |
Wholebrain | 3.7 | ![]() |
colon | 4.5 | ![]() |
pineal_day | 5.48 | ![]() |
pineal_night | 5.42 | ![]() |
retina | 5.425 | ![]() |
small_intestine | 4.35 | ![]() |
- Probe name: A_23_P100177
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 2.1 ± 0.98 | ![]() ![]() ![]() |
Basal Forebrain | 1.61 ± 0.21 | ![]() ![]() ![]() |
Basal Part of Pons | 1.82 ± 0.75 | ![]() ![]() ![]() |
Cerebellar Cortex | 1.79 ± 0.83 | ![]() ![]() ![]() |
Cerebellar Nuclei | 2 ± 0.67 | ![]() ![]() ![]() |
Claustrum | 2.47 ± 0.71 | ![]() ![]() ![]() |
Epithalamus | 1.4 ± 0.73 | ![]() ![]() ![]() |
Frontal Lobe | 1.7 ± 0.68 | ![]() ![]() ![]() |
Globus Pallidus | 2.16 ± 0.3 | ![]() ![]() ![]() |
Hypothalamus | 1.72 ± 0.57 | ![]() ![]() ![]() |
Insula | 1.61 ± 0.34 | ![]() ![]() ![]() |
Limbic Lobe | 1.71 ± 0.58 | ![]() ![]() ![]() |
Mesencephalon | 1.88 ± 0.72 | ![]() ![]() ![]() |
Myelencephalon | 1.83 ± 0.61 | ![]() ![]() ![]() |
Occipital Lobe | 1.82 ± 0.53 | ![]() ![]() ![]() |
Parietal Lobe | 1.81 ± 0.82 | ![]() ![]() ![]() |
Pontine Tegmentum | 1.71 ± 0.62 | ![]() ![]() ![]() |
Striatum | 1.76 ± 0.47 | ![]() ![]() ![]() |
Subthalamus | 1.92 ± 0.67 | ![]() ![]() ![]() |
Temporal Lobe | 1.67 ± 0.62 | ![]() ![]() ![]() |
Thalamus | 2.03 ± 0.61 | ![]() ![]() ![]() |
White Matter | 2.23 ± 0.4 | ![]() ![]() ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00501489 | 39 | 569 | 607 | WPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNK | Peptide Atlas |