Annotation Detail for MTTP


Gene Symbol: | MTTP ( ABL,MGC149819,MGC149820,MTP ) |
---|---|
Gene Full Name: | microsomal triglyceride transfer protein |
Band: | 4q23 |
Quick Links | Entrez ID:4547; OMIM: 157147; Uniprot ID:MTP_HUMAN; ENSEMBL ID: ENSG00000138823; HGNC ID: 7467 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.195799
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 17 / 564012 | 30 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 5 / 55556 | 89 | ![]() |
adult | 9 / 1939121 | 4 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 1 / 114246 | 8 | ![]() |
esophageal tumor | 1 / 17290 | 57 | ![]() |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 1 / 263845 | 3 | ![]() |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 1 / 95842 | 10 | ![]() |
liver tumor | 11 / 96359 | 114 | ![]() |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 4 / 97250 | 41 | ![]() |
normal | 52 / 3360307 | 15 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 1 / 123478 | 8 | ![]() |
bone | 0 / 71655 | 0 | |
bone marrow | 0 / 48801 | 0 | |
brain | 12 / 1100989 | 10 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 0 / 149255 | 0 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 1 / 20209 | 49 | ![]() |
eye | 1 / 211054 | 4 | ![]() |
heart | 0 / 89626 | 0 | |
intestine | 10 / 234472 | 42 | ![]() |
kidney | 10 / 211777 | 47 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 21 / 207743 | 101 | ![]() |
lung | 0 / 336974 | 0 | |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 0 / 153271 | 0 | |
mouth | 0 / 67052 | 0 | |
muscle | 2 / 107715 | 18 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 0 / 280825 | 0 | |
prostate | 1 / 189345 | 5 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 0 / 210574 | 0 | |
spleen | 0 / 53952 | 0 | |
stomach | 0 / 96619 | 0 | |
testis | 24 / 330442 | 72 | ![]() |
thymus | 0 / 81131 | 0 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 0 / 232878 | 0 | |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 205675_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 8.7 | ![]() |
Adipocyte | 8.25 | ![]() |
AdrenalCortex | 10.9 | ![]() |
Adrenalgland | 7.35 | ![]() |
Amygdala | 7.7 | ![]() |
Appendix | 11 | ![]() |
AtrioventricularNode | 9.05 | ![]() |
BDCA4+_DentriticCells | 8.4 | ![]() |
Bonemarrow | 9.5 | ![]() |
BronchialEpithelialCells | 7.6 | ![]() |
CD105+_Endothelial | 8.4 | ![]() |
CD14+_Monocytes | 8.7 | ![]() |
CD19+_BCells(neg._sel.) | 8.45 | ![]() |
CD33+_Myeloid | 11.1 | ![]() |
CD34+ | 10.2 | ![]() |
CD4+_Tcells | 8.15 | ![]() |
CD56+_NKCells | 9.25 | ![]() |
CD71+_EarlyErythroid | 7.9 | ![]() |
CD8+_Tcells | 6.95 | ![]() |
CardiacMyocytes | 12.6 | ![]() |
Caudatenucleus | 7.45 | ![]() |
Cerebellum | 6.75 | ![]() |
CerebellumPeduncles | 10.45 | ![]() |
CiliaryGanglion | 8.45 | ![]() |
CingulateCortex | 8.75 | ![]() |
Colorectaladenocarcinoma | 8.1 | ![]() |
DorsalRootGanglion | 7.75 | ![]() |
FetalThyroid | 8.35 | ![]() |
Fetalbrain | 8.35 | ![]() |
Fetalliver | 65.55 | ![]() |
Fetallung | 6.6 | ![]() |
GlobusPallidus | 6.75 | ![]() |
Heart | 16.75 | ![]() |
Hypothalamus | 8.55 | ![]() |
Kidney | 8.15 | ![]() |
Leukemia_chronicMyelogenousK-562 | 7.45 | ![]() |
Leukemia_promyelocytic-HL-60 | 7.2 | ![]() |
Leukemialymphoblastic(MOLT-4) | 6.7 | ![]() |
Liver | 31.3 | ![]() |
Lung | 8.9 | ![]() |
Lymphnode | 7.05 | ![]() |
Lymphoma_burkitts(Daudi) | 11.2 | ![]() |
Lymphoma_burkitts(Raji) | 12.4 | ![]() |
MedullaOblongata | 7.85 | ![]() |
OccipitalLobe | 7.3 | ![]() |
OlfactoryBulb | 6.25 | ![]() |
Ovary | 6.7 | ![]() |
Pancreas | 7.05 | ![]() |
PancreaticIslet | 9 | ![]() |
ParietalLobe | 9.35 | ![]() |
Pituitary | 9.75 | ![]() |
Placenta | 7.8 | ![]() |
Pons | 8.35 | ![]() |
PrefrontalCortex | 9.5 | ![]() |
Prostate | 9.55 | ![]() |
Salivarygland | 6.9 | ![]() |
SkeletalMuscle | 14.15 | ![]() |
Skin | 9.1 | ![]() |
SmoothMuscle | 9.25 | ![]() |
Spinalcord | 8.95 | ![]() |
SubthalamicNucleus | 7.8 | ![]() |
SuperiorCervicalGanglion | 12.85 | ![]() |
TemporalLobe | 7.9 | ![]() |
Testis | 7.1 | ![]() |
TestisGermCell | 7 | ![]() |
TestisIntersitial | 7.35 | ![]() |
TestisLeydigCell | 8.9 | ![]() |
TestisSeminiferousTubule | 7.05 | ![]() |
Thalamus | 8.6 | ![]() |
Thymus | 6.15 | ![]() |
Thyroid | 9.75 | ![]() |
Tongue | 9.4 | ![]() |
Tonsil | 8.3 | ![]() |
Trachea | 6.9 | ![]() |
TrigeminalGanglion | 10.35 | ![]() |
Uterus | 6.45 | ![]() |
UterusCorpus | 8.1 | ![]() |
WholeBlood | 8.8 | ![]() |
Wholebrain | 6.15 | ![]() |
colon | 8.25 | ![]() |
pineal_day | 9.82 | ![]() |
pineal_night | 9.7 | ![]() |
retina | 9.7 | ![]() |
small_intestine | 1226 | ![]() |
- Probe name: CUST_288_PI417507815
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.78 ± 0.8 | ![]() ![]() ![]() |
Basal Forebrain | 3.43 ± 0.55 | ![]() ![]() ![]() |
Basal Part of Pons | 3.86 ± 0.45 | ![]() ![]() ![]() |
Cerebellar Cortex | 3.25 ± 0.57 | ![]() ![]() ![]() |
Cerebellar Nuclei | 3.38 ± 0.62 | ![]() ![]() ![]() |
Claustrum | 4.14 ± 0.56 | ![]() ![]() ![]() |
Epithalamus | 5.8 ± 0.43 | ![]() ![]() ![]() |
Frontal Lobe | 4.09 ± 0.73 | ![]() ![]() ![]() |
Globus Pallidus | 4.85 ± 0.55 | ![]() ![]() ![]() |
Hypothalamus | 4.16 ± 0.77 | ![]() ![]() ![]() |
Insula | 3.5 ± 0.79 | ![]() ![]() ![]() |
Limbic Lobe | 3.59 ± 0.74 | ![]() ![]() ![]() |
Mesencephalon | 3.95 ± 0.82 | ![]() ![]() ![]() |
Myelencephalon | 3.85 ± 0.75 | ![]() ![]() ![]() |
Occipital Lobe | 3.82 ± 0.61 | ![]() ![]() ![]() |
Parietal Lobe | 3.71 ± 0.79 | ![]() ![]() ![]() |
Pontine Tegmentum | 3.83 ± 0.77 | ![]() ![]() ![]() |
Striatum | 3.59 ± 1.04 | ![]() ![]() ![]() |
Subthalamus | 3.47 ± 0.24 | ![]() ![]() ![]() |
Temporal Lobe | 3.58 ± 0.68 | ![]() ![]() ![]() |
Thalamus | 4.16 ± 0.47 | ![]() ![]() ![]() |
White Matter | 4.71 ± 0.61 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Mttp | CB | Cerebellum | 12.18 | ![]() |
19.24 | ![]() | |||
Mttp | CTX | Cerebral cortex | 31.43 | ![]() |
23.38 | ![]() | |||
Mttp | HIP | Hippocampal region | 15.78 | ![]() |
23.12 | ![]() | |||
Mttp | HPF | Hippocampal formation | 17.58 | ![]() |
20.4 | ![]() | |||
Mttp | HY | Hypothalamus | 43.64 | ![]() |
35.56 | ![]() | |||
Mttp | LSX | Lateral septal complex | 60.92 | ![]() |
46.18 | ![]() | |||
Mttp | MB | Midbrain | 17.03 | ![]() |
19.05 | ![]() | |||
Mttp | MY | Medulla | 8.69 | ![]() |
10.96 | ![]() | |||
Mttp | OLF | Olfactory bulb | 27.73 | ![]() |
22.24 | ![]() | |||
Mttp | P | Pons | 15.05 | ![]() |
18.25 | ![]() | |||
Mttp | PAL | Pallidum | 44.92 | ![]() |
39.53 | ![]() | |||
Mttp | RHP | Retrohippocampal region | 21.85 | ![]() |
16.49 | ![]() | |||
Mttp | sAMY | Striatum-like amygdalar nuclei | 37.41 | ![]() |
27.91 | ![]() | |||
Mttp | STR | Striatum | 28.26 | ![]() |
22.77 | ![]() | |||
Mttp | STRd | Striatum dorsal region | 19.95 | ![]() |
17.69 | ![]() | |||
Mttp | STRv | Striatum ventral region | 40.28 | ![]() |
28.34 | ![]() | |||
Mttp | TH | Thalamus | 32.9 | ![]() |
32.01 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
MTP_HUMAN_540 | 33 | 540 | 572 | TAAAAIILNNNPSYMDVKNILLSIGELPQEMNK | PRIDE |
PAp00002244 | 20 | 860 | 879 | ESVLAGCEFPLHQENSEMCK | Peptide Atlas |