Annotation Detail for MTTP
Basic Information Top
| Gene Symbol: | MTTP ( ABL,MGC149819,MGC149820,MTP ) |
|---|---|
| Gene Full Name: | microsomal triglyceride transfer protein |
| Band: | 4q23 |
| Quick Links | Entrez ID:4547; OMIM: 157147; Uniprot ID:MTP_HUMAN; ENSEMBL ID: ENSG00000138823; HGNC ID: 7467 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.195799
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
 | |||
| embryoid body | 0 / 70761 | 0 | |
| blastocyst | 0 / 62319 | 0 | |
| fetus | 17 / 564012 | 30 |  |
| neonate | 0 / 31097 | 0 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 5 / 55556 | 89 |  |
| adult | 9 / 1939121 | 4 |  |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
| |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 0 / 94178 | 0 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 0 / 82823 | 0 | |
| colorectal tumor | 1 / 114246 | 8 | |
| esophageal tumor | 1 / 17290 | 57 | |
| gastrointestinal tumor | 0 / 119369 | 0 | |
| germ cell tumor | 1 / 263845 | 3 | |
| glioma | 0 / 106883 | 0 | |
| head and neck tumor | 0 / 136302 | 0 | |
| kidney tumor | 0 / 68959 | 0 | |
| leukemia | 1 / 95842 | 10 | |
| liver tumor | 11 / 96359 | 114 | |
| lung tumor | 0 / 103127 | 0 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 4 / 97250 | 41 | |
| normal | 52 / 3360307 | 15 | |
| ovarian tumor | 0 / 76682 | 0 | |
| pancreatic tumor | 0 / 104616 | 0 | |
| primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
| prostate cancer | 0 / 102680 | 0 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
| uterine tumor | 0 / 90257 | 0 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
| |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 0 / 29757 | 0 | |
| blood | 1 / 123478 | 8 | |
| bone | 0 / 71655 | 0 | |
| bone marrow | 0 / 48801 | 0 | |
| brain | 12 / 1100989 | 10 | |
| cervix | 0 / 48171 | 0 | |
| connective tissue | 0 / 149255 | 0 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 0 / 215722 | 0 | |
| esophagus | 1 / 20209 | 49 | |
| eye | 1 / 211054 | 4 | |
| heart | 0 / 89626 | 0 | |
| intestine | 10 / 234472 | 42 | |
| kidney | 10 / 211777 | 47 | |
| larynx | 0 / 24145 | 0 | |
| liver | 21 / 207743 | 101 | |
| lung | 0 / 336974 | 0 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 0 / 153271 | 0 | |
| mouth | 0 / 67052 | 0 | |
| muscle | 2 / 107715 | 18 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 0 / 102051 | 0 | |
| pancreas | 0 / 214812 | 0 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 0 / 280825 | 0 | |
| prostate | 1 / 189345 | 5 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 0 / 210574 | 0 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 0 / 96619 | 0 | |
| testis | 24 / 330442 | 72 | |
| thymus | 0 / 81131 | 0 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 0 / 232878 | 0 | |
| vascular | 1 / 51780 | 19 | |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 205675_at
| Cell line | Expression level | Expression bar |
|---|---|---|
| ||
| 721_B_lymphoblasts | 8.7 | |
| Adipocyte | 8.25 | |
| AdrenalCortex | 10.9 | |
| Adrenalgland | 7.35 | |
| Amygdala | 7.7 | |
| Appendix | 11 | |
| AtrioventricularNode | 9.05 | |
| BDCA4+_DentriticCells | 8.4 | |
| Bonemarrow | 9.5 | |
| BronchialEpithelialCells | 7.6 | |
| CD105+_Endothelial | 8.4 | |
| CD14+_Monocytes | 8.7 | |
| CD19+_BCells(neg._sel.) | 8.45 | |
| CD33+_Myeloid | 11.1 | |
| CD34+ | 10.2 | |
| CD4+_Tcells | 8.15 | |
| CD56+_NKCells | 9.25 | |
| CD71+_EarlyErythroid | 7.9 | |
| CD8+_Tcells | 6.95 | |
| CardiacMyocytes | 12.6 | |
| Caudatenucleus | 7.45 | |
| Cerebellum | 6.75 | |
| CerebellumPeduncles | 10.45 | |
| CiliaryGanglion | 8.45 | |
| CingulateCortex | 8.75 | |
| Colorectaladenocarcinoma | 8.1 | |
| DorsalRootGanglion | 7.75 | |
| FetalThyroid | 8.35 | |
| Fetalbrain | 8.35 | |
| Fetalliver | 65.55 | |
| Fetallung | 6.6 | |
| GlobusPallidus | 6.75 | |
| Heart | 16.75 | |
| Hypothalamus | 8.55 | |
| Kidney | 8.15 | |
| Leukemia_chronicMyelogenousK-562 | 7.45 | |
| Leukemia_promyelocytic-HL-60 | 7.2 | |
| Leukemialymphoblastic(MOLT-4) | 6.7 | |
| Liver | 31.3 | |
| Lung | 8.9 | |
| Lymphnode | 7.05 | |
| Lymphoma_burkitts(Daudi) | 11.2 | |
| Lymphoma_burkitts(Raji) | 12.4 | |
| MedullaOblongata | 7.85 | |
| OccipitalLobe | 7.3 | |
| OlfactoryBulb | 6.25 | |
| Ovary | 6.7 | |
| Pancreas | 7.05 | |
| PancreaticIslet | 9 | |
| ParietalLobe | 9.35 | |
| Pituitary | 9.75 | |
| Placenta | 7.8 | |
| Pons | 8.35 | |
| PrefrontalCortex | 9.5 | |
| Prostate | 9.55 | |
| Salivarygland | 6.9 | |
| SkeletalMuscle | 14.15 | |
| Skin | 9.1 | |
| SmoothMuscle | 9.25 | |
| Spinalcord | 8.95 | |
| SubthalamicNucleus | 7.8 | |
| SuperiorCervicalGanglion | 12.85 | |
| TemporalLobe | 7.9 | |
| Testis | 7.1 | |
| TestisGermCell | 7 | |
| TestisIntersitial | 7.35 | |
| TestisLeydigCell | 8.9 | |
| TestisSeminiferousTubule | 7.05 | |
| Thalamus | 8.6 | |
| Thymus | 6.15 | |
| Thyroid | 9.75 | |
| Tongue | 9.4 | |
| Tonsil | 8.3 | |
| Trachea | 6.9 | |
| TrigeminalGanglion | 10.35 | |
| Uterus | 6.45 | |
| UterusCorpus | 8.1 | |
| WholeBlood | 8.8 | |
| Wholebrain | 6.15 | |
| colon | 8.25 | |
| pineal_day | 9.82 | |
| pineal_night | 9.7 | |
| retina | 9.7 | |
| small_intestine | 1226 |  |
- Probe name: CUST_288_PI417507815
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 3.78 ± 0.8 | ![](../"images/bar_3.png"){kind=small}   |
| Basal Forebrain | 3.43 ± 0.55 | |
| Basal Part of Pons | 3.86 ± 0.45 | |
| Cerebellar Cortex | 3.25 ± 0.57 | |
| Cerebellar Nuclei | 3.38 ± 0.62 | |
| Claustrum | 4.14 ± 0.56 | |
| Epithalamus | 5.8 ± 0.43 | |
| Frontal Lobe | 4.09 ± 0.73 | |
| Globus Pallidus | 4.85 ± 0.55 | |
| Hypothalamus | 4.16 ± 0.77 | |
| Insula | 3.5 ± 0.79 | |
| Limbic Lobe | 3.59 ± 0.74 | |
| Mesencephalon | 3.95 ± 0.82 | |
| Myelencephalon | 3.85 ± 0.75 | |
| Occipital Lobe | 3.82 ± 0.61 | |
| Parietal Lobe | 3.71 ± 0.79 | |
| Pontine Tegmentum | 3.83 ± 0.77 | |
| Striatum | 3.59 ± 1.04 | |
| Subthalamus | 3.47 ± 0.24 | |
| Temporal Lobe | 3.58 ± 0.68 | |
| Thalamus | 4.16 ± 0.47 | |
| White Matter | 4.71 ± 0.61 | |
Mouse Brain ISH 
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Mttp | CB | Cerebellum | 12.18 | |
| 19.24 | | |||
| Mttp | CTX | Cerebral cortex | 31.43 | |
| 23.38 | | |||
| Mttp | HIP | Hippocampal region | 15.78 | |
| 23.12 | | |||
| Mttp | HPF | Hippocampal formation | 17.58 | |
| 20.4 | | |||
| Mttp | HY | Hypothalamus | 43.64 | |
| 35.56 | | |||
| Mttp | LSX | Lateral septal complex | 60.92 | |
| 46.18 | | |||
| Mttp | MB | Midbrain | 17.03 | |
| 19.05 | | |||
| Mttp | MY | Medulla | 8.69 | |
| 10.96 | | |||
| Mttp | OLF | Olfactory bulb | 27.73 | |
| 22.24 | | |||
| Mttp | P | Pons | 15.05 | |
| 18.25 | | |||
| Mttp | PAL | Pallidum | 44.92 | |
| 39.53 | | |||
| Mttp | RHP | Retrohippocampal region | 21.85 | |
| 16.49 | | |||
| Mttp | sAMY | Striatum-like amygdalar nuclei | 37.41 | |
| 27.91 | | |||
| Mttp | STR | Striatum | 28.26 | |
| 22.77 | | |||
| Mttp | STRd | Striatum dorsal region | 19.95 | |
| 17.69 | | |||
| Mttp | STRv | Striatum ventral region | 40.28 | |
| 28.34 | | |||
| Mttp | TH | Thalamus | 32.9 | |
| 32.01 | |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| MTP_HUMAN_540 | 33 | 540 | 572 | TAAAAIILNNNPSYMDVKNILLSIGELPQEMNK | PRIDE |
| PAp00002244 | 20 | 860 | 879 | ESVLAGCEFPLHQENSEMCK | Peptide Atlas |