Annotation Detail for NDUFB2
Basic Information Top
| Gene Symbol: | NDUFB2 ( AGGG,CI-AGGG,MGC70788 ) |
|---|---|
| Gene Full Name: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa |
| Band: | 7q34 |
| Quick Links | Entrez ID:4708; OMIM: 603838; Uniprot ID:NDUB2_HUMAN; ENSEMBL ID: ENSG00000090266; HGNC ID: 7697 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.655788
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 1 / 70761 | 14 | |
| blastocyst | 2 / 62319 | 32 | |
| fetus | 29 / 564012 | 51 | |
| neonate | 3 / 31097 | 96 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 128 / 1939121 | 66 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 1 / 17475 | 57 | |
| breast (mammary gland) tumor | 4 / 94178 | 42 | |
| cervical tumor | 1 / 34366 | 29 | |
| chondrosarcoma | 2 / 82823 | 24 | |
| colorectal tumor | 0 / 114246 | 0 | |
| esophageal tumor | 1 / 17290 | 57 | |
| gastrointestinal tumor | 12 / 119369 | 100 | |
| germ cell tumor | 5 / 263845 | 18 | |
| glioma | 14 / 106883 | 130 | |
| head and neck tumor | 8 / 136302 | 58 | |
| kidney tumor | 9 / 68959 | 130 | |
| leukemia | 3 / 95842 | 31 | |
| liver tumor | 6 / 96359 | 62 | |
| lung tumor | 3 / 103127 | 29 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 2 / 97250 | 20 | |
| normal | 220 / 3360307 | 65 | |
| ovarian tumor | 3 / 76682 | 39 | |
| pancreatic tumor | 5 / 104616 | 47 | |
| primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | |
| prostate cancer | 6 / 102680 | 58 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 2 / 124949 | 16 | |
| soft tissue/muscle tissue tumor | 9 / 125191 | 71 | |
| uterine tumor | 11 / 90257 | 121 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 1 / 33197 | 30 | |
| ascites | 2 / 40015 | 49 | |
| bladder | 1 / 29757 | 33 | |
| blood | 5 / 123478 | 40 | |
| bone | 1 / 71655 | 13 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 61 / 1100989 | 55 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 12 / 149255 | 80 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 5 / 215722 | 23 | |
| esophagus | 1 / 20209 | 49 | |
| eye | 11 / 211054 | 52 | |
| heart | 13 / 89626 | 145 | |
| intestine | 12 / 234472 | 51 | |
| kidney | 16 / 211777 | 75 | |
| larynx | 2 / 24145 | 82 | |
| liver | 16 / 207743 | 77 | |
| lung | 8 / 336974 | 23 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 7 / 153271 | 45 | |
| mouth | 1 / 67052 | 14 | |
| muscle | 22 / 107715 | 204 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 4 / 102051 | 39 | |
| pancreas | 9 / 214812 | 41 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 3 / 41328 | 72 | |
| pituitary gland | 3 / 16585 | 180 | |
| placenta | 12 / 280825 | 42 | |
| prostate | 12 / 189345 | 63 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 4 / 210574 | 18 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 9 / 96619 | 93 | |
| testis | 11 / 330442 | 33 | |
| thymus | 1 / 81131 | 12 | |
| thyroid | 9 / 47473 | 189 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 1 / 52413 | 19 | |
| umbilical cord | 3 / 13680 | 219 | |
| uterus | 23 / 232878 | 98 | |
| vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218200_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 1271.5 | |
| Adipocyte | 770.8 | |
| AdrenalCortex | 372.8 | |
| Adrenalgland | 450.7 | |
| Amygdala | 952.7 | |
| Appendix | 290.7 | |
| AtrioventricularNode | 86.45 | |
| BDCA4+_DentriticCells | 1151.15 | |
| Bonemarrow | 256.65 | |
| BronchialEpithelialCells | 880.45 | |
| CD105+_Endothelial | 894.85 | |
| CD14+_Monocytes | 1544.45 | |
| CD19+_BCells(neg._sel.) | 1006.35 | |
| CD33+_Myeloid | 1670.1 | |
| CD34+ | 1655.75 | |
| CD4+_Tcells | 901 | |
| CD56+_NKCells | 2025.95 | |
| CD71+_EarlyErythroid | 520.7 | |
| CD8+_Tcells | 729.65 | |
| CardiacMyocytes | 620.15 | |
| Caudatenucleus | 798.5 | |
| Cerebellum | 754.75 | |
| CerebellumPeduncles | 1242.85 | |
| CiliaryGanglion | 110.05 | |
| CingulateCortex | 734.25 | |
| Colorectaladenocarcinoma | 671.3 | |
| DorsalRootGanglion | 199.75 | |
| FetalThyroid | 1379.75 | |
| Fetalbrain | 429.1 | |
| Fetalliver | 150.5 | |
| Fetallung | 355.2 | |
| GlobusPallidus | 410.1 | |
| Heart | 4751.25 | |
| Hypothalamus | 1367.8 | |
| Kidney | 679.1 | |
| Leukemia_chronicMyelogenousK-562 | 450.5 | |
| Leukemia_promyelocytic-HL-60 | 636.05 | |
| Leukemialymphoblastic(MOLT-4) | 677.55 | |
| Liver | 921.7 | |
| Lung | 1028.4 | |
| Lymphnode | 352.25 | |
| Lymphoma_burkitts(Daudi) | 877.15 | |
| Lymphoma_burkitts(Raji) | 511.65 | |
| MedullaOblongata | 779.4 | |
| OccipitalLobe | 784.55 | |
| OlfactoryBulb | 412.65 | |
| Ovary | 194.9 | |
| Pancreas | 290.9 | |
| PancreaticIslet | 526.95 | |
| ParietalLobe | 718.35 | |
| Pituitary | 592.35 | |
| Placenta | 431.6 | |
| Pons | 629.05 | |
| PrefrontalCortex | 691.7 | |
| Prostate | 1193.9 | |
| Salivarygland | 381.85 | |
| SkeletalMuscle | 476.8 | |
| Skin | 155.55 | |
| SmoothMuscle | 986.8 | |
| Spinalcord | 939.05 | |
| SubthalamicNucleus | 596.25 | |
| SuperiorCervicalGanglion | 134.05 | |
| TemporalLobe | 941.35 | |
| Testis | 554.1 | |
| TestisGermCell | 470.5 | |
| TestisIntersitial | 428.9 | |
| TestisLeydigCell | 293.35 | |
| TestisSeminiferousTubule | 309 | |
| Thalamus | 1216.6 | |
| Thymus | 550.45 | |
| Thyroid | 2161.65 | |
| Tongue | 668.45 | |
| Tonsil | 441.95 | |
| Trachea | 305.55 | |
| TrigeminalGanglion | 101.2 | |
| Uterus | 531 | |
| UterusCorpus | 227.5 | |
| WholeBlood | 371.25 | |
| Wholebrain | 2402.2 | |
| colon | 877.5 | |
| pineal_day | 2680.54 | |
| pineal_night | 2467.94 | |
| retina | 1165.425 | |
| small_intestine | 530.85 |
- Probe name: CUST_5784_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 12.45 ± 0.47 | |
| Basal Forebrain | 12.61 ± 0.21 | |
| Basal Part of Pons | 13.07 ± 0.28 | |
| Cerebellar Cortex | 12.84 ± 0.41 | |
| Cerebellar Nuclei | 13.01 ± 0.38 | |
| Claustrum | 12.15 ± 0.78 | |
| Epithalamus | 12.59 ± 0.25 | |
| Frontal Lobe | 12.96 ± 0.36 | |
| Globus Pallidus | 12.95 ± 0.27 | |
| Hypothalamus | 13.12 ± 0.13 | |
| Insula | 12.93 ± 0.3 | |
| Limbic Lobe | 12.35 ± 0.67 | |
| Mesencephalon | 12.63 ± 0.53 | |
| Myelencephalon | 12.67 ± 0.52 | |
| Occipital Lobe | 12.01 ± 0.6 | |
| Parietal Lobe | 12.73 ± 0.47 | |
| Pontine Tegmentum | 12.84 ± 0.41 | |
| Striatum | 12.44 ± 0.47 | |
| Subthalamus | 13.24 ± 0.21 | |
| Temporal Lobe | 12.87 ± 0.41 | |
| Thalamus | 12.78 ± 0.39 | |
| White Matter | 12.71 ± 0.34 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Ndufb2 | CB | Cerebellum | 16.92 | |
| 24.59 | ||||
| Ndufb2 | CTX | Cerebral cortex | 21.04 | |
| 16.63 | ||||
| Ndufb2 | HIP | Hippocampal region | 15.49 | |
| 17.05 | ||||
| Ndufb2 | HPF | Hippocampal formation | 15.25 | |
| 15.25 | ||||
| Ndufb2 | HY | Hypothalamus | 8.42 | |
| 8.56 | ||||
| Ndufb2 | LSX | Lateral septal complex | 2.51 | |
| 1.59 | ||||
| Ndufb2 | MB | Midbrain | 10.96 | |
| 12.13 | ||||
| Ndufb2 | MY | Medulla | 19.91 | |
| 27.73 | ||||
| Ndufb2 | OLF | Olfactory bulb | 15.72 | |
| 13.38 | ||||
| Ndufb2 | P | Pons | 14.62 | |
| 19.91 | ||||
| Ndufb2 | PAL | Pallidum | 12.3 | |
| 13.34 | ||||
| Ndufb2 | RHP | Retrohippocampal region | 14.65 | |
| 12.41 | ||||
| Ndufb2 | sAMY | Striatum-like amygdalar nuclei | 10.63 | |
| 7.5 | ||||
| Ndufb2 | STR | Striatum | 8.11 | |
| 6.58 | ||||
| Ndufb2 | STRd | Striatum dorsal region | 7.57 | |
| 6.36 | ||||
| Ndufb2 | STRv | Striatum ventral region | 11.16 | |
| 8.64 | ||||
| Ndufb2 | TH | Thalamus | 15.66 | |
| 15.48 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| NDUB2_HUMAN_34 | 10 | 34 | 43 | AGGGVHIEPR | PRIDE |
| NDUB2_HUMAN_44 | 9 | 44 | 52 | YRQFPQLTR | PRIDE |
| NDUB2_HUMAN_46 | 7 | 46 | 52 | QFPQLTR | PRIDE |
| PAp00040343 | 33 | 73 | 105 | FWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED | Peptide Atlas |



