Annotation Detail for NSF
Basic Information Top
| Gene Symbol: | NSF ( SKD2 ) |
|---|---|
| Gene Full Name: | N-ethylmaleimide-sensitive factor |
| Band: | 17q21.31 |
| Quick Links | Entrez ID:4905; OMIM: 601633; Uniprot ID:NSF_HUMAN; ENSEMBL ID: ENSG00000073969; HGNC ID: 8016 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.431279
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 2 / 70761 | 28 | |
| blastocyst | 1 / 62319 | 16 | |
| fetus | 52 / 564012 | 92 | |
| neonate | 1 / 31097 | 32 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 4 / 55556 | 71 | |
| adult | 184 / 1939121 | 94 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 6 / 94178 | 63 | |
| cervical tumor | 4 / 34366 | 116 | |
| chondrosarcoma | 7 / 82823 | 84 | |
| colorectal tumor | 5 / 114246 | 43 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 15 / 119369 | 125 | |
| germ cell tumor | 32 / 263845 | 121 | |
| glioma | 3 / 106883 | 28 | |
| head and neck tumor | 18 / 136302 | 132 | |
| kidney tumor | 7 / 68959 | 101 | |
| leukemia | 4 / 95842 | 41 | |
| liver tumor | 5 / 96359 | 51 | |
| lung tumor | 9 / 103127 | 87 | |
| lymphoma | 2 / 71755 | 27 | |
| non-neoplasia | 13 / 97250 | 133 | |
| normal | 1002 / 3360307 | 298 | |
| ovarian tumor | 2 / 76682 | 26 | |
| pancreatic tumor | 2 / 104616 | 19 | |
| primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | |
| prostate cancer | 2 / 102680 | 19 | |
| retinoblastoma | 3 / 46356 | 64 | |
| skin tumor | 3 / 124949 | 24 | |
| soft tissue/muscle tissue tumor | 41 / 125191 | 327 | |
| uterine tumor | 3 / 90257 | 33 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 4 / 33197 | 120 | |
| ascites | 10 / 40015 | 249 | |
| bladder | 2 / 29757 | 67 | |
| blood | 7 / 123478 | 56 | |
| bone | 3 / 71655 | 41 | |
| bone marrow | 2 / 48801 | 40 | |
| brain | 929 / 1100989 | 843 | |
| cervix | 7 / 48171 | 145 | |
| connective tissue | 48 / 149255 | 321 | |
| ear | 3 / 16212 | 185 | |
| embryonic tissue | 3 / 215722 | 13 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 18 / 211054 | 85 | |
| heart | 13 / 89626 | 145 | |
| intestine | 10 / 234472 | 42 | |
| kidney | 16 / 211777 | 75 | |
| larynx | 0 / 24145 | 0 | |
| liver | 9 / 207743 | 43 | |
| lung | 26 / 336974 | 77 | |
| lymph | 1 / 44270 | 22 | |
| lymph node | 7 / 91610 | 76 | |
| mammary gland | 9 / 153271 | 58 | |
| mouth | 20 / 67052 | 298 | |
| muscle | 2 / 107715 | 18 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 2 / 102051 | 19 | |
| pancreas | 4 / 214812 | 18 | |
| parathyroid | 3 / 20539 | 146 | |
| pharynx | 3 / 41328 | 72 | |
| pituitary gland | 4 / 16585 | 241 | |
| placenta | 14 / 280825 | 49 | |
| prostate | 3 / 189345 | 15 | |
| salivary gland | 1 / 20155 | 49 | |
| skin | 21 / 210574 | 99 | |
| spleen | 2 / 53952 | 37 | |
| stomach | 5 / 96619 | 51 | |
| testis | 59 / 330442 | 178 | |
| thymus | 5 / 81131 | 61 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 10 / 52413 | 190 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 16 / 232878 | 68 | |
| vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202395_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 94.45 | |
| Adipocyte | 51.2 | |
| AdrenalCortex | 17.6 | |
| Adrenalgland | 24.3 | |
| Amygdala | 1637.5 | |
| Appendix | 15.3 | |
| AtrioventricularNode | 11.95 | |
| BDCA4+_DentriticCells | 111.4 | |
| Bonemarrow | 20.85 | |
| BronchialEpithelialCells | 29.55 | |
| CD105+_Endothelial | 44.1 | |
| CD14+_Monocytes | 133.3 | |
| CD19+_BCells(neg._sel.) | 65.05 | |
| CD33+_Myeloid | 123.2 | |
| CD34+ | 66.15 | |
| CD4+_Tcells | 47.25 | |
| CD56+_NKCells | 60.35 | |
| CD71+_EarlyErythroid | 16.45 | |
| CD8+_Tcells | 53.95 | |
| CardiacMyocytes | 36.15 | |
| Caudatenucleus | 780.75 | |
| Cerebellum | 215.15 | |
| CerebellumPeduncles | 397.6 | |
| CiliaryGanglion | 24.6 | |
| CingulateCortex | 826.9 | |
| Colorectaladenocarcinoma | 27.85 | |
| DorsalRootGanglion | 39.45 | |
| FetalThyroid | 34 | |
| Fetalbrain | 162.45 | |
| Fetalliver | 14.15 | |
| Fetallung | 18.25 | |
| GlobusPallidus | 537.8 | |
| Heart | 12.85 | |
| Hypothalamus | 1406.2 | |
| Kidney | 16.85 | |
| Leukemia_chronicMyelogenousK-562 | 25.85 | |
| Leukemia_promyelocytic-HL-60 | 56.25 | |
| Leukemialymphoblastic(MOLT-4) | 40.45 | |
| Liver | 15.35 | |
| Lung | 23.65 | |
| Lymphnode | 40.95 | |
| Lymphoma_burkitts(Daudi) | 57.4 | |
| Lymphoma_burkitts(Raji) | 88.05 | |
| MedullaOblongata | 891.55 | |
| OccipitalLobe | 1164 | |
| OlfactoryBulb | 17.9 | |
| Ovary | 10.8 | |
| Pancreas | 36.7 | |
| PancreaticIslet | 124.85 | |
| ParietalLobe | 1113.5 | |
| Pituitary | 342.5 | |
| Placenta | 52.45 | |
| Pons | 524.95 | |
| PrefrontalCortex | 1520.3 | |
| Prostate | 58.95 | |
| Salivarygland | 24.95 | |
| SkeletalMuscle | 13.2 | |
| Skin | 15.8 | |
| SmoothMuscle | 81.45 | |
| Spinalcord | 206.1 | |
| SubthalamicNucleus | 692.1 | |
| SuperiorCervicalGanglion | 22.45 | |
| TemporalLobe | 685.35 | |
| Testis | 25.5 | |
| TestisGermCell | 51.55 | |
| TestisIntersitial | 25 | |
| TestisLeydigCell | 23.65 | |
| TestisSeminiferousTubule | 32.55 | |
| Thalamus | 945.1 | |
| Thymus | 35.3 | |
| Thyroid | 56.9 | |
| Tongue | 17.2 | |
| Tonsil | 46.1 | |
| Trachea | 41.65 | |
| TrigeminalGanglion | 17.65 | |
| Uterus | 19.55 | |
| UterusCorpus | 13.05 | |
| WholeBlood | 67.25 | |
| Wholebrain | 882.5 | |
| colon | 50.35 | |
| pineal_day | 1534.96 | |
| pineal_night | 1584.9 | |
| retina | 137.375 | |
| small_intestine | 45.35 |
- Probe name: A_24_P221634
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 10.92 ± 0.28 | |
| Basal Forebrain | 10.38 ± 0.16 | |
| Basal Part of Pons | 11.45 ± 0.09 | |
| Cerebellar Cortex | 10.45 ± 0.23 | |
| Cerebellar Nuclei | 10.81 ± 0.42 | |
| Claustrum | 10.99 ± 0.19 | |
| Epithalamus | 9.83 ± 0.71 | |
| Frontal Lobe | 10.77 ± 0.49 | |
| Globus Pallidus | 9.75 ± 0.57 | |
| Hypothalamus | 10.7 ± 0.41 | |
| Insula | 10.73 ± 0.31 | |
| Limbic Lobe | 10.97 ± 0.41 | |
| Mesencephalon | 10.58 ± 0.5 | |
| Myelencephalon | 10.64 ± 0.54 | |
| Occipital Lobe | 10.61 ± 0.4 | |
| Parietal Lobe | 10.92 ± 0.41 | |
| Pontine Tegmentum | 10.6 ± 0.3 | |
| Striatum | 10.59 ± 0.51 | |
| Subthalamus | 11.1 ± 0.24 | |
| Temporal Lobe | 10.84 ± 0.3 | |
| Thalamus | 10.48 ± 0.3 | |
| White Matter | 9.01 ± 0.46 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Nsf | CB | Cerebellum | 100 | |
| 100 | ||||
| Nsf | CTX | Cerebral cortex | 100 | |
| 100 | ||||
| Nsf | HIP | Hippocampal region | 100 | |
| 100 | ||||
| Nsf | HPF | Hippocampal formation | 100 | |
| 100 | ||||
| Nsf | HY | Hypothalamus | 100 | |
| 100 | ||||
| Nsf | LSX | Lateral septal complex | 100 | |
| 100 | ||||
| Nsf | MB | Midbrain | 100 | |
| 100 | ||||
| Nsf | MY | Medulla | 100 | |
| 100 | ||||
| Nsf | OLF | Olfactory bulb | 100 | |
| 100 | ||||
| Nsf | P | Pons | 100 | |
| 100 | ||||
| Nsf | PAL | Pallidum | 100 | |
| 100 | ||||
| Nsf | RHP | Retrohippocampal region | 100 | |
| 100 | ||||
| Nsf | sAMY | Striatum-like amygdalar nuclei | 100 | |
| 100 | ||||
| Nsf | STR | Striatum | 100 | |
| 100 | ||||
| Nsf | STRd | Striatum dorsal region | 100 | |
| 100 | ||||
| Nsf | STRv | Striatum ventral region | 100 | |
| 100 | ||||
| Nsf | TH | Thalamus | 100 | |
| 100 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| NSF_HUMAN_357 | 35 | 357 | 391 | IDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVK | PRIDE |
| NSF_HUMAN_434 | 12 | 434 | 445 | NFSGAELEGLVR | PRIDE |
| NSF_HUMAN_617 | 14 | 617 | 630 | FSNLVLQALLVLLK | PRIDE |
| NSF_HUMAN_617 | 15 | 617 | 631 | FSNLVLQALLVLLKK | PRIDE |
| NSF_HUMAN_617 | 21 | 617 | 637 | FSNLVLQALLVLLKKAPPQGR | PRIDE |
| PAp00001584 | 11 | 28 | 38 | DFQSGQHVIVR | Peptide Atlas |



