Annotation Detail for NSF
Basic Information Top
Gene Symbol: | NSF ( SKD2 ) |
---|---|
Gene Full Name: | N-ethylmaleimide-sensitive factor |
Band: | 17q21.31 |
Quick Links | Entrez ID:4905; OMIM: 601633; Uniprot ID:NSF_HUMAN; ENSEMBL ID: ENSG00000073969; HGNC ID: 8016 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.431279
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 2 / 70761 | 28 | |
blastocyst | 1 / 62319 | 16 | |
fetus | 52 / 564012 | 92 | |
neonate | 1 / 31097 | 32 | |
infant | 1 / 23620 | 42 | |
juvenile | 4 / 55556 | 71 | |
adult | 184 / 1939121 | 94 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 6 / 94178 | 63 | |
cervical tumor | 4 / 34366 | 116 | |
chondrosarcoma | 7 / 82823 | 84 | |
colorectal tumor | 5 / 114246 | 43 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 15 / 119369 | 125 | |
germ cell tumor | 32 / 263845 | 121 | |
glioma | 3 / 106883 | 28 | |
head and neck tumor | 18 / 136302 | 132 | |
kidney tumor | 7 / 68959 | 101 | |
leukemia | 4 / 95842 | 41 | |
liver tumor | 5 / 96359 | 51 | |
lung tumor | 9 / 103127 | 87 | |
lymphoma | 2 / 71755 | 27 | |
non-neoplasia | 13 / 97250 | 133 | |
normal | 1002 / 3360307 | 298 | |
ovarian tumor | 2 / 76682 | 26 | |
pancreatic tumor | 2 / 104616 | 19 | |
primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | |
prostate cancer | 2 / 102680 | 19 | |
retinoblastoma | 3 / 46356 | 64 | |
skin tumor | 3 / 124949 | 24 | |
soft tissue/muscle tissue tumor | 41 / 125191 | 327 | |
uterine tumor | 3 / 90257 | 33 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 1 / 13106 | 76 | |
adrenal gland | 4 / 33197 | 120 | |
ascites | 10 / 40015 | 249 | |
bladder | 2 / 29757 | 67 | |
blood | 7 / 123478 | 56 | |
bone | 3 / 71655 | 41 | |
bone marrow | 2 / 48801 | 40 | |
brain | 929 / 1100989 | 843 | |
cervix | 7 / 48171 | 145 | |
connective tissue | 48 / 149255 | 321 | |
ear | 3 / 16212 | 185 | |
embryonic tissue | 3 / 215722 | 13 | |
esophagus | 0 / 20209 | 0 | |
eye | 18 / 211054 | 85 | |
heart | 13 / 89626 | 145 | |
intestine | 10 / 234472 | 42 | |
kidney | 16 / 211777 | 75 | |
larynx | 0 / 24145 | 0 | |
liver | 9 / 207743 | 43 | |
lung | 26 / 336974 | 77 | |
lymph | 1 / 44270 | 22 | |
lymph node | 7 / 91610 | 76 | |
mammary gland | 9 / 153271 | 58 | |
mouth | 20 / 67052 | 298 | |
muscle | 2 / 107715 | 18 | |
nerve | 1 / 15768 | 63 | |
ovary | 2 / 102051 | 19 | |
pancreas | 4 / 214812 | 18 | |
parathyroid | 3 / 20539 | 146 | |
pharynx | 3 / 41328 | 72 | |
pituitary gland | 4 / 16585 | 241 | |
placenta | 14 / 280825 | 49 | |
prostate | 3 / 189345 | 15 | |
salivary gland | 1 / 20155 | 49 | |
skin | 21 / 210574 | 99 | |
spleen | 2 / 53952 | 37 | |
stomach | 5 / 96619 | 51 | |
testis | 59 / 330442 | 178 | |
thymus | 5 / 81131 | 61 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 10 / 52413 | 190 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 16 / 232878 | 68 | |
vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202395_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 94.45 | |
Adipocyte | 51.2 | |
AdrenalCortex | 17.6 | |
Adrenalgland | 24.3 | |
Amygdala | 1637.5 | |
Appendix | 15.3 | |
AtrioventricularNode | 11.95 | |
BDCA4+_DentriticCells | 111.4 | |
Bonemarrow | 20.85 | |
BronchialEpithelialCells | 29.55 | |
CD105+_Endothelial | 44.1 | |
CD14+_Monocytes | 133.3 | |
CD19+_BCells(neg._sel.) | 65.05 | |
CD33+_Myeloid | 123.2 | |
CD34+ | 66.15 | |
CD4+_Tcells | 47.25 | |
CD56+_NKCells | 60.35 | |
CD71+_EarlyErythroid | 16.45 | |
CD8+_Tcells | 53.95 | |
CardiacMyocytes | 36.15 | |
Caudatenucleus | 780.75 | |
Cerebellum | 215.15 | |
CerebellumPeduncles | 397.6 | |
CiliaryGanglion | 24.6 | |
CingulateCortex | 826.9 | |
Colorectaladenocarcinoma | 27.85 | |
DorsalRootGanglion | 39.45 | |
FetalThyroid | 34 | |
Fetalbrain | 162.45 | |
Fetalliver | 14.15 | |
Fetallung | 18.25 | |
GlobusPallidus | 537.8 | |
Heart | 12.85 | |
Hypothalamus | 1406.2 | |
Kidney | 16.85 | |
Leukemia_chronicMyelogenousK-562 | 25.85 | |
Leukemia_promyelocytic-HL-60 | 56.25 | |
Leukemialymphoblastic(MOLT-4) | 40.45 | |
Liver | 15.35 | |
Lung | 23.65 | |
Lymphnode | 40.95 | |
Lymphoma_burkitts(Daudi) | 57.4 | |
Lymphoma_burkitts(Raji) | 88.05 | |
MedullaOblongata | 891.55 | |
OccipitalLobe | 1164 | |
OlfactoryBulb | 17.9 | |
Ovary | 10.8 | |
Pancreas | 36.7 | |
PancreaticIslet | 124.85 | |
ParietalLobe | 1113.5 | |
Pituitary | 342.5 | |
Placenta | 52.45 | |
Pons | 524.95 | |
PrefrontalCortex | 1520.3 | |
Prostate | 58.95 | |
Salivarygland | 24.95 | |
SkeletalMuscle | 13.2 | |
Skin | 15.8 | |
SmoothMuscle | 81.45 | |
Spinalcord | 206.1 | |
SubthalamicNucleus | 692.1 | |
SuperiorCervicalGanglion | 22.45 | |
TemporalLobe | 685.35 | |
Testis | 25.5 | |
TestisGermCell | 51.55 | |
TestisIntersitial | 25 | |
TestisLeydigCell | 23.65 | |
TestisSeminiferousTubule | 32.55 | |
Thalamus | 945.1 | |
Thymus | 35.3 | |
Thyroid | 56.9 | |
Tongue | 17.2 | |
Tonsil | 46.1 | |
Trachea | 41.65 | |
TrigeminalGanglion | 17.65 | |
Uterus | 19.55 | |
UterusCorpus | 13.05 | |
WholeBlood | 67.25 | |
Wholebrain | 882.5 | |
colon | 50.35 | |
pineal_day | 1534.96 | |
pineal_night | 1584.9 | |
retina | 137.375 | |
small_intestine | 45.35 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_24_P221634
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 10.92 ± 0.28 | |
Basal Forebrain | 10.38 ± 0.16 | |
Basal Part of Pons | 11.45 ± 0.09 | |
Cerebellar Cortex | 10.45 ± 0.23 | |
Cerebellar Nuclei | 10.81 ± 0.42 | |
Claustrum | 10.99 ± 0.19 | |
Epithalamus | 9.83 ± 0.71 | |
Frontal Lobe | 10.77 ± 0.49 | |
Globus Pallidus | 9.75 ± 0.57 | |
Hypothalamus | 10.7 ± 0.41 | |
Insula | 10.73 ± 0.31 | |
Limbic Lobe | 10.97 ± 0.41 | |
Mesencephalon | 10.58 ± 0.5 | |
Myelencephalon | 10.64 ± 0.54 | |
Occipital Lobe | 10.61 ± 0.4 | |
Parietal Lobe | 10.92 ± 0.41 | |
Pontine Tegmentum | 10.6 ± 0.3 | |
Striatum | 10.59 ± 0.51 | |
Subthalamus | 11.1 ± 0.24 | |
Temporal Lobe | 10.84 ± 0.3 | |
Thalamus | 10.48 ± 0.3 | |
White Matter | 9.01 ± 0.46 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Nsf | CB | Cerebellum | 100 | |
100 | ||||
Nsf | CTX | Cerebral cortex | 100 | |
100 | ||||
Nsf | HIP | Hippocampal region | 100 | |
100 | ||||
Nsf | HPF | Hippocampal formation | 100 | |
100 | ||||
Nsf | HY | Hypothalamus | 100 | |
100 | ||||
Nsf | LSX | Lateral septal complex | 100 | |
100 | ||||
Nsf | MB | Midbrain | 100 | |
100 | ||||
Nsf | MY | Medulla | 100 | |
100 | ||||
Nsf | OLF | Olfactory bulb | 100 | |
100 | ||||
Nsf | P | Pons | 100 | |
100 | ||||
Nsf | PAL | Pallidum | 100 | |
100 | ||||
Nsf | RHP | Retrohippocampal region | 100 | |
100 | ||||
Nsf | sAMY | Striatum-like amygdalar nuclei | 100 | |
100 | ||||
Nsf | STR | Striatum | 100 | |
100 | ||||
Nsf | STRd | Striatum dorsal region | 100 | |
100 | ||||
Nsf | STRv | Striatum ventral region | 100 | |
100 | ||||
Nsf | TH | Thalamus | 100 | |
100 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
NSF_HUMAN_357 | 35 | 357 | 391 | IDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVK | PRIDE |
NSF_HUMAN_434 | 12 | 434 | 445 | NFSGAELEGLVR | PRIDE |
NSF_HUMAN_617 | 14 | 617 | 630 | FSNLVLQALLVLLK | PRIDE |
NSF_HUMAN_617 | 15 | 617 | 631 | FSNLVLQALLVLLKK | PRIDE |
NSF_HUMAN_617 | 21 | 617 | 637 | FSNLVLQALLVLLKKAPPQGR | PRIDE |
PAp00001584 | 11 | 28 | 38 | DFQSGQHVIVR | Peptide Atlas |