Annotation Detail for PCMT1
Basic Information Top
| Gene Symbol: | PCMT1 ( - ) |
|---|---|
| Gene Full Name: | protein-L-isoaspartate (D-aspartate) O-methyltransferase |
| Band: | 6q25.1 |
| Quick Links | Entrez ID:5110; OMIM: 176851; Uniprot ID:PIMT_HUMAN; ENSEMBL ID: ENSG00000120265; HGNC ID: 8728 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.279257
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 4 / 70761 | 56 | |
| blastocyst | 6 / 62319 | 96 | |
| fetus | 46 / 564012 | 81 | |
| neonate | 1 / 31097 | 32 | |
| infant | 18 / 23620 | 762 | |
| juvenile | 5 / 55556 | 89 | |
| adult | 213 / 1939121 | 109 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 1 / 17475 | 57 | |
| breast (mammary gland) tumor | 13 / 94178 | 138 | |
| cervical tumor | 2 / 34366 | 58 | |
| chondrosarcoma | 11 / 82823 | 132 | |
| colorectal tumor | 10 / 114246 | 87 | |
| esophageal tumor | 3 / 17290 | 173 | |
| gastrointestinal tumor | 16 / 119369 | 134 | |
| germ cell tumor | 11 / 263845 | 41 | |
| glioma | 5 / 106883 | 46 | |
| head and neck tumor | 15 / 136302 | 110 | |
| kidney tumor | 5 / 68959 | 72 | |
| leukemia | 12 / 95842 | 125 | |
| liver tumor | 8 / 96359 | 83 | |
| lung tumor | 9 / 103127 | 87 | |
| lymphoma | 4 / 71755 | 55 | |
| non-neoplasia | 35 / 97250 | 359 | |
| normal | 424 / 3360307 | 126 | |
| ovarian tumor | 6 / 76682 | 78 | |
| pancreatic tumor | 12 / 104616 | 114 | |
| primitive neuroectodermal tumor of the CNS | 35 / 125680 | 278 | |
| prostate cancer | 12 / 102680 | 116 | |
| retinoblastoma | 4 / 46356 | 86 | |
| skin tumor | 31 / 124949 | 248 | |
| soft tissue/muscle tissue tumor | 16 / 125191 | 127 | |
| uterine tumor | 8 / 90257 | 88 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 4 / 13106 | 305 | |
| adrenal gland | 1 / 33197 | 30 | |
| ascites | 7 / 40015 | 174 | |
| bladder | 1 / 29757 | 33 | |
| blood | 11 / 123478 | 89 | |
| bone | 12 / 71655 | 167 | |
| bone marrow | 7 / 48801 | 143 | |
| brain | 304 / 1100989 | 276 | |
| cervix | 4 / 48171 | 83 | |
| connective tissue | 19 / 149255 | 127 | |
| ear | 2 / 16212 | 123 | |
| embryonic tissue | 22 / 215722 | 101 | |
| esophagus | 5 / 20209 | 247 | |
| eye | 23 / 211054 | 108 | |
| heart | 20 / 89626 | 223 | |
| intestine | 27 / 234472 | 115 | |
| kidney | 15 / 211777 | 70 | |
| larynx | 1 / 24145 | 41 | |
| liver | 20 / 207743 | 96 | |
| lung | 33 / 336974 | 97 | |
| lymph | 3 / 44270 | 67 | |
| lymph node | 3 / 91610 | 32 | |
| mammary gland | 23 / 153271 | 150 | |
| mouth | 10 / 67052 | 149 | |
| muscle | 12 / 107715 | 111 | |
| nerve | 3 / 15768 | 190 | |
| ovary | 7 / 102051 | 68 | |
| pancreas | 19 / 214812 | 88 | |
| parathyroid | 3 / 20539 | 146 | |
| pharynx | 3 / 41328 | 72 | |
| pituitary gland | 4 / 16585 | 241 | |
| placenta | 25 / 280825 | 89 | |
| prostate | 17 / 189345 | 89 | |
| salivary gland | 3 / 20155 | 148 | |
| skin | 39 / 210574 | 185 | |
| spleen | 3 / 53952 | 55 | |
| stomach | 8 / 96619 | 82 | |
| testis | 42 / 330442 | 127 | |
| thymus | 0 / 81131 | 0 | |
| thyroid | 3 / 47473 | 63 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 1 / 13680 | 73 | |
| uterus | 24 / 232878 | 103 | |
| vascular | 4 / 51780 | 77 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 210156_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 445.25 | |
| Adipocyte | 156.05 | |
| AdrenalCortex | 139.9 | |
| Adrenalgland | 94.5 | |
| Amygdala | 264.6 | |
| Appendix | 122.25 | |
| AtrioventricularNode | 117.6 | |
| BDCA4+_DentriticCells | 186.3 | |
| Bonemarrow | 159.95 | |
| BronchialEpithelialCells | 280.85 | |
| CD105+_Endothelial | 238.05 | |
| CD14+_Monocytes | 395.05 | |
| CD19+_BCells(neg._sel.) | 167 | |
| CD33+_Myeloid | 533.15 | |
| CD34+ | 218.4 | |
| CD4+_Tcells | 194.65 | |
| CD56+_NKCells | 206.75 | |
| CD71+_EarlyErythroid | 503.7 | |
| CD8+_Tcells | 144.55 | |
| CardiacMyocytes | 245.55 | |
| Caudatenucleus | 151.6 | |
| Cerebellum | 104.85 | |
| CerebellumPeduncles | 161.1 | |
| CiliaryGanglion | 108.6 | |
| CingulateCortex | 187.05 | |
| Colorectaladenocarcinoma | 168.5 | |
| DorsalRootGanglion | 126.65 | |
| FetalThyroid | 119.1 | |
| Fetalbrain | 174.3 | |
| Fetalliver | 124.45 | |
| Fetallung | 100 | |
| GlobusPallidus | 202.2 | |
| Heart | 106.4 | |
| Hypothalamus | 229.05 | |
| Kidney | 79.65 | |
| Leukemia_chronicMyelogenousK-562 | 224 | |
| Leukemia_promyelocytic-HL-60 | 217.1 | |
| Leukemialymphoblastic(MOLT-4) | 143.35 | |
| Liver | 102.15 | |
| Lung | 144.6 | |
| Lymphnode | 76.75 | |
| Lymphoma_burkitts(Daudi) | 199 | |
| Lymphoma_burkitts(Raji) | 267.05 | |
| MedullaOblongata | 157.55 | |
| OccipitalLobe | 313.3 | |
| OlfactoryBulb | 136.95 | |
| Ovary | 85.25 | |
| Pancreas | 107.35 | |
| PancreaticIslet | 160.9 | |
| ParietalLobe | 251.35 | |
| Pituitary | 160.5 | |
| Placenta | 150.4 | |
| Pons | 150.1 | |
| PrefrontalCortex | 213.1 | |
| Prostate | 155.5 | |
| Salivarygland | 106.05 | |
| SkeletalMuscle | 95.3 | |
| Skin | 114.5 | |
| SmoothMuscle | 271.6 | |
| Spinalcord | 145.55 | |
| SubthalamicNucleus | 192.9 | |
| SuperiorCervicalGanglion | 133.9 | |
| TemporalLobe | 202.85 | |
| Testis | 191.05 | |
| TestisGermCell | 315.75 | |
| TestisIntersitial | 355.4 | |
| TestisLeydigCell | 266.1 | |
| TestisSeminiferousTubule | 213.45 | |
| Thalamus | 254.65 | |
| Thymus | 121.6 | |
| Thyroid | 170 | |
| Tongue | 96.8 | |
| Tonsil | 122.4 | |
| Trachea | 117.2 | |
| TrigeminalGanglion | 135.35 | |
| Uterus | 113.1 | |
| UterusCorpus | 99.2 | |
| WholeBlood | 175.05 | |
| Wholebrain | 362.5 | |
| colon | 160.35 | |
| pineal_day | 171.28 | |
| pineal_night | 185.46 | |
| retina | 158.725 | |
| small_intestine | 153.9 |
- Probe name: A_24_P283320
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 7.41 ± 0.29 | |
| Basal Forebrain | 6.85 ± 0.17 | |
| Basal Part of Pons | 7.38 ± 0.23 | |
| Cerebellar Cortex | 7.01 ± 0.32 | |
| Cerebellar Nuclei | 6.91 ± 0.59 | |
| Claustrum | 7.1 ± 0.39 | |
| Epithalamus | 6.67 ± 0.37 | |
| Frontal Lobe | 7.29 ± 0.36 | |
| Globus Pallidus | 6.17 ± 0.57 | |
| Hypothalamus | 7.16 ± 0.33 | |
| Insula | 7.13 ± 0.32 | |
| Limbic Lobe | 7.21 ± 0.42 | |
| Mesencephalon | 6.89 ± 0.61 | |
| Myelencephalon | 6.98 ± 0.51 | |
| Occipital Lobe | 6.71 ± 0.54 | |
| Parietal Lobe | 7.08 ± 0.47 | |
| Pontine Tegmentum | 7.09 ± 0.46 | |
| Striatum | 6.62 ± 0.55 | |
| Subthalamus | 6.78 ± 0.44 | |
| Temporal Lobe | 7.19 ± 0.38 | |
| Thalamus | 6.83 ± 0.48 | |
| White Matter | 6.59 ± 0.2 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Pcmt1 | CB | Cerebellum | 1.51 | |
| 2.35 | ||||
| Pcmt1 | CTX | Cerebral cortex | 2.29 | |
| 2.09 | ||||
| Pcmt1 | HIP | Hippocampal region | 5.72 | |
| 6.1 | ||||
| Pcmt1 | HPF | Hippocampal formation | 3.97 | |
| 3.87 | ||||
| Pcmt1 | HY | Hypothalamus | 0.52 | |
| 0.59 | ||||
| Pcmt1 | LSX | Lateral septal complex | 0.18 | |
| 0.1 | ||||
| Pcmt1 | MB | Midbrain | 1.63 | |
| 2.18 | ||||
| Pcmt1 | MY | Medulla | 6.14 | |
| 9.61 | ||||
| Pcmt1 | OLF | Olfactory bulb | 1.2 | |
| 2.25 | ||||
| Pcmt1 | P | Pons | 4.63 | |
| 7.65 | ||||
| Pcmt1 | PAL | Pallidum | 0.46 | |
| 0.53 | ||||
| Pcmt1 | RHP | Retrohippocampal region | 0.94 | |
| 0.66 | ||||
| Pcmt1 | sAMY | Striatum-like amygdalar nuclei | 0.2 | |
| 0.18 | ||||
| Pcmt1 | STR | Striatum | 0.22 | |
| 0.26 | ||||
| Pcmt1 | STRd | Striatum dorsal region | 0.22 | |
| 0.26 | ||||
| Pcmt1 | STRv | Striatum ventral region | 0.17 | |
| 0.17 | ||||
| Pcmt1 | TH | Thalamus | 0.82 | |
| 0.89 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00000520 | 17 | 140 | 156 | ALDVGSGSGILTACFAR | Peptide Atlas |
| PIMT_HUMAN_105 | 19 | 105 | 123 | VIGIDHIKELVDDSINNVR | PRIDE |
| PIMT_HUMAN_113 | 11 | 113 | 123 | ELVDDSINNVR | PRIDE |
| PIMT_HUMAN_124 | 11 | 124 | 134 | KDDPTLLSSGR | PRIDE |
| PIMT_HUMAN_125 | 19 | 125 | 143 | DDPTLLSSGRVQLVVGDGR | PRIDE |
| PIMT_HUMAN_135 | 9 | 135 | 143 | VQLVVGDGR | PRIDE |
| PIMT_HUMAN_144 | 34 | 144 | 177 | MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR | PRIDE |
| PIMT_HUMAN_178 | 26 | 178 | 203 | LILPVGPAGGNQMLEQYDKLQDGSIK | PRIDE |
| PIMT_HUMAN_204 | 15 | 204 | 218 | MKPLMGVIYVPLTDK | PRIDE |
| PIMT_HUMAN_204 | 17 | 204 | 220 | MKPLMGVIYVPLTDKEK | PRIDE |
| PIMT_HUMAN_24 | 13 | 24 | 36 | TDKVFEVMLATDR | PRIDE |
| PIMT_HUMAN_4 | 14 | 4 | 17 | SGGASHSELIHNLR | PRIDE |
| PIMT_HUMAN_81 | 17 | 81 | 97 | ALDVGSGSGILTACFAR | PRIDE |



