Annotation Detail for PCMT1
![](img/hide.gif)
![](img/arrow-up.png)
Gene Symbol: | PCMT1 ( - ) |
---|---|
Gene Full Name: | protein-L-isoaspartate (D-aspartate) O-methyltransferase |
Band: | 6q25.1 |
Quick Links | Entrez ID:5110; OMIM: 176851; Uniprot ID:PIMT_HUMAN; ENSEMBL ID: ENSG00000120265; HGNC ID: 8728 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.279257
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 4 / 70761 | 56 | ![]() |
blastocyst | 6 / 62319 | 96 | ![]() |
fetus | 46 / 564012 | 81 | ![]() |
neonate | 1 / 31097 | 32 | ![]() |
infant | 18 / 23620 | 762 | ![]() |
juvenile | 5 / 55556 | 89 | ![]() |
adult | 213 / 1939121 | 109 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 1 / 17475 | 57 | ![]() |
breast (mammary gland) tumor | 13 / 94178 | 138 | ![]() |
cervical tumor | 2 / 34366 | 58 | ![]() |
chondrosarcoma | 11 / 82823 | 132 | ![]() |
colorectal tumor | 10 / 114246 | 87 | ![]() |
esophageal tumor | 3 / 17290 | 173 | ![]() |
gastrointestinal tumor | 16 / 119369 | 134 | ![]() |
germ cell tumor | 11 / 263845 | 41 | ![]() |
glioma | 5 / 106883 | 46 | ![]() |
head and neck tumor | 15 / 136302 | 110 | ![]() |
kidney tumor | 5 / 68959 | 72 | ![]() |
leukemia | 12 / 95842 | 125 | ![]() |
liver tumor | 8 / 96359 | 83 | ![]() |
lung tumor | 9 / 103127 | 87 | ![]() |
lymphoma | 4 / 71755 | 55 | ![]() |
non-neoplasia | 35 / 97250 | 359 | ![]() |
normal | 424 / 3360307 | 126 | ![]() |
ovarian tumor | 6 / 76682 | 78 | ![]() |
pancreatic tumor | 12 / 104616 | 114 | ![]() |
primitive neuroectodermal tumor of the CNS | 35 / 125680 | 278 | ![]() |
prostate cancer | 12 / 102680 | 116 | ![]() |
retinoblastoma | 4 / 46356 | 86 | ![]() |
skin tumor | 31 / 124949 | 248 | ![]() |
soft tissue/muscle tissue tumor | 16 / 125191 | 127 | ![]() |
uterine tumor | 8 / 90257 | 88 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 4 / 13106 | 305 | ![]() |
adrenal gland | 1 / 33197 | 30 | ![]() |
ascites | 7 / 40015 | 174 | ![]() |
bladder | 1 / 29757 | 33 | ![]() |
blood | 11 / 123478 | 89 | ![]() |
bone | 12 / 71655 | 167 | ![]() |
bone marrow | 7 / 48801 | 143 | ![]() |
brain | 304 / 1100989 | 276 | ![]() |
cervix | 4 / 48171 | 83 | ![]() |
connective tissue | 19 / 149255 | 127 | ![]() |
ear | 2 / 16212 | 123 | ![]() |
embryonic tissue | 22 / 215722 | 101 | ![]() |
esophagus | 5 / 20209 | 247 | ![]() |
eye | 23 / 211054 | 108 | ![]() |
heart | 20 / 89626 | 223 | ![]() |
intestine | 27 / 234472 | 115 | ![]() |
kidney | 15 / 211777 | 70 | ![]() |
larynx | 1 / 24145 | 41 | ![]() |
liver | 20 / 207743 | 96 | ![]() |
lung | 33 / 336974 | 97 | ![]() |
lymph | 3 / 44270 | 67 | ![]() |
lymph node | 3 / 91610 | 32 | ![]() |
mammary gland | 23 / 153271 | 150 | ![]() |
mouth | 10 / 67052 | 149 | ![]() |
muscle | 12 / 107715 | 111 | ![]() |
nerve | 3 / 15768 | 190 | ![]() |
ovary | 7 / 102051 | 68 | ![]() |
pancreas | 19 / 214812 | 88 | ![]() |
parathyroid | 3 / 20539 | 146 | ![]() |
pharynx | 3 / 41328 | 72 | ![]() |
pituitary gland | 4 / 16585 | 241 | ![]() |
placenta | 25 / 280825 | 89 | ![]() |
prostate | 17 / 189345 | 89 | ![]() |
salivary gland | 3 / 20155 | 148 | ![]() |
skin | 39 / 210574 | 185 | ![]() |
spleen | 3 / 53952 | 55 | ![]() |
stomach | 8 / 96619 | 82 | ![]() |
testis | 42 / 330442 | 127 | ![]() |
thymus | 0 / 81131 | 0 | |
thyroid | 3 / 47473 | 63 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 1 / 13680 | 73 | ![]() |
uterus | 24 / 232878 | 103 | ![]() |
vascular | 4 / 51780 | 77 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 210156_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 445.25 | ![]() |
Adipocyte | 156.05 | ![]() |
AdrenalCortex | 139.9 | ![]() |
Adrenalgland | 94.5 | ![]() |
Amygdala | 264.6 | ![]() |
Appendix | 122.25 | ![]() |
AtrioventricularNode | 117.6 | ![]() |
BDCA4+_DentriticCells | 186.3 | ![]() |
Bonemarrow | 159.95 | ![]() |
BronchialEpithelialCells | 280.85 | ![]() |
CD105+_Endothelial | 238.05 | ![]() |
CD14+_Monocytes | 395.05 | ![]() |
CD19+_BCells(neg._sel.) | 167 | ![]() |
CD33+_Myeloid | 533.15 | ![]() |
CD34+ | 218.4 | ![]() |
CD4+_Tcells | 194.65 | ![]() |
CD56+_NKCells | 206.75 | ![]() |
CD71+_EarlyErythroid | 503.7 | ![]() |
CD8+_Tcells | 144.55 | ![]() |
CardiacMyocytes | 245.55 | ![]() |
Caudatenucleus | 151.6 | ![]() |
Cerebellum | 104.85 | ![]() |
CerebellumPeduncles | 161.1 | ![]() |
CiliaryGanglion | 108.6 | ![]() |
CingulateCortex | 187.05 | ![]() |
Colorectaladenocarcinoma | 168.5 | ![]() |
DorsalRootGanglion | 126.65 | ![]() |
FetalThyroid | 119.1 | ![]() |
Fetalbrain | 174.3 | ![]() |
Fetalliver | 124.45 | ![]() |
Fetallung | 100 | ![]() |
GlobusPallidus | 202.2 | ![]() |
Heart | 106.4 | ![]() |
Hypothalamus | 229.05 | ![]() |
Kidney | 79.65 | ![]() |
Leukemia_chronicMyelogenousK-562 | 224 | ![]() |
Leukemia_promyelocytic-HL-60 | 217.1 | ![]() |
Leukemialymphoblastic(MOLT-4) | 143.35 | ![]() |
Liver | 102.15 | ![]() |
Lung | 144.6 | ![]() |
Lymphnode | 76.75 | ![]() |
Lymphoma_burkitts(Daudi) | 199 | ![]() |
Lymphoma_burkitts(Raji) | 267.05 | ![]() |
MedullaOblongata | 157.55 | ![]() |
OccipitalLobe | 313.3 | ![]() |
OlfactoryBulb | 136.95 | ![]() |
Ovary | 85.25 | ![]() |
Pancreas | 107.35 | ![]() |
PancreaticIslet | 160.9 | ![]() |
ParietalLobe | 251.35 | ![]() |
Pituitary | 160.5 | ![]() |
Placenta | 150.4 | ![]() |
Pons | 150.1 | ![]() |
PrefrontalCortex | 213.1 | ![]() |
Prostate | 155.5 | ![]() |
Salivarygland | 106.05 | ![]() |
SkeletalMuscle | 95.3 | ![]() |
Skin | 114.5 | ![]() |
SmoothMuscle | 271.6 | ![]() |
Spinalcord | 145.55 | ![]() |
SubthalamicNucleus | 192.9 | ![]() |
SuperiorCervicalGanglion | 133.9 | ![]() |
TemporalLobe | 202.85 | ![]() |
Testis | 191.05 | ![]() |
TestisGermCell | 315.75 | ![]() |
TestisIntersitial | 355.4 | ![]() |
TestisLeydigCell | 266.1 | ![]() |
TestisSeminiferousTubule | 213.45 | ![]() |
Thalamus | 254.65 | ![]() |
Thymus | 121.6 | ![]() |
Thyroid | 170 | ![]() |
Tongue | 96.8 | ![]() |
Tonsil | 122.4 | ![]() |
Trachea | 117.2 | ![]() |
TrigeminalGanglion | 135.35 | ![]() |
Uterus | 113.1 | ![]() |
UterusCorpus | 99.2 | ![]() |
WholeBlood | 175.05 | ![]() |
Wholebrain | 362.5 | ![]() |
colon | 160.35 | ![]() |
pineal_day | 171.28 | ![]() |
pineal_night | 185.46 | ![]() |
retina | 158.725 | ![]() |
small_intestine | 153.9 | ![]() |
- Probe name: A_24_P283320
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 7.41 ± 0.29 | ![]() ![]() ![]() |
Basal Forebrain | 6.85 ± 0.17 | ![]() ![]() ![]() |
Basal Part of Pons | 7.38 ± 0.23 | ![]() ![]() ![]() |
Cerebellar Cortex | 7.01 ± 0.32 | ![]() ![]() ![]() |
Cerebellar Nuclei | 6.91 ± 0.59 | ![]() ![]() ![]() |
Claustrum | 7.1 ± 0.39 | ![]() ![]() ![]() |
Epithalamus | 6.67 ± 0.37 | ![]() ![]() ![]() |
Frontal Lobe | 7.29 ± 0.36 | ![]() ![]() ![]() |
Globus Pallidus | 6.17 ± 0.57 | ![]() ![]() ![]() |
Hypothalamus | 7.16 ± 0.33 | ![]() ![]() ![]() |
Insula | 7.13 ± 0.32 | ![]() ![]() ![]() |
Limbic Lobe | 7.21 ± 0.42 | ![]() ![]() ![]() |
Mesencephalon | 6.89 ± 0.61 | ![]() ![]() ![]() |
Myelencephalon | 6.98 ± 0.51 | ![]() ![]() ![]() |
Occipital Lobe | 6.71 ± 0.54 | ![]() ![]() ![]() |
Parietal Lobe | 7.08 ± 0.47 | ![]() ![]() ![]() |
Pontine Tegmentum | 7.09 ± 0.46 | ![]() ![]() ![]() |
Striatum | 6.62 ± 0.55 | ![]() ![]() ![]() |
Subthalamus | 6.78 ± 0.44 | ![]() ![]() ![]() |
Temporal Lobe | 7.19 ± 0.38 | ![]() ![]() ![]() |
Thalamus | 6.83 ± 0.48 | ![]() ![]() ![]() |
White Matter | 6.59 ± 0.2 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Pcmt1 | CB | Cerebellum | 1.51 | ![]() |
2.35 | ![]() | |||
Pcmt1 | CTX | Cerebral cortex | 2.29 | ![]() |
2.09 | ![]() | |||
Pcmt1 | HIP | Hippocampal region | 5.72 | ![]() |
6.1 | ![]() | |||
Pcmt1 | HPF | Hippocampal formation | 3.97 | ![]() |
3.87 | ![]() | |||
Pcmt1 | HY | Hypothalamus | 0.52 | ![]() |
0.59 | ![]() | |||
Pcmt1 | LSX | Lateral septal complex | 0.18 | ![]() |
0.1 | ![]() | |||
Pcmt1 | MB | Midbrain | 1.63 | ![]() |
2.18 | ![]() | |||
Pcmt1 | MY | Medulla | 6.14 | ![]() |
9.61 | ![]() | |||
Pcmt1 | OLF | Olfactory bulb | 1.2 | ![]() |
2.25 | ![]() | |||
Pcmt1 | P | Pons | 4.63 | ![]() |
7.65 | ![]() | |||
Pcmt1 | PAL | Pallidum | 0.46 | ![]() |
0.53 | ![]() | |||
Pcmt1 | RHP | Retrohippocampal region | 0.94 | ![]() |
0.66 | ![]() | |||
Pcmt1 | sAMY | Striatum-like amygdalar nuclei | 0.2 | ![]() |
0.18 | ![]() | |||
Pcmt1 | STR | Striatum | 0.22 | ![]() |
0.26 | ![]() | |||
Pcmt1 | STRd | Striatum dorsal region | 0.22 | ![]() |
0.26 | ![]() | |||
Pcmt1 | STRv | Striatum ventral region | 0.17 | ![]() |
0.17 | ![]() | |||
Pcmt1 | TH | Thalamus | 0.82 | ![]() |
0.89 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00000520 | 17 | 140 | 156 | ALDVGSGSGILTACFAR | Peptide Atlas |
PIMT_HUMAN_105 | 19 | 105 | 123 | VIGIDHIKELVDDSINNVR | PRIDE |
PIMT_HUMAN_113 | 11 | 113 | 123 | ELVDDSINNVR | PRIDE |
PIMT_HUMAN_124 | 11 | 124 | 134 | KDDPTLLSSGR | PRIDE |
PIMT_HUMAN_125 | 19 | 125 | 143 | DDPTLLSSGRVQLVVGDGR | PRIDE |
PIMT_HUMAN_135 | 9 | 135 | 143 | VQLVVGDGR | PRIDE |
PIMT_HUMAN_144 | 34 | 144 | 177 | MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR | PRIDE |
PIMT_HUMAN_178 | 26 | 178 | 203 | LILPVGPAGGNQMLEQYDKLQDGSIK | PRIDE |
PIMT_HUMAN_204 | 15 | 204 | 218 | MKPLMGVIYVPLTDK | PRIDE |
PIMT_HUMAN_204 | 17 | 204 | 220 | MKPLMGVIYVPLTDKEK | PRIDE |
PIMT_HUMAN_24 | 13 | 24 | 36 | TDKVFEVMLATDR | PRIDE |
PIMT_HUMAN_4 | 14 | 4 | 17 | SGGASHSELIHNLR | PRIDE |
PIMT_HUMAN_81 | 17 | 81 | 97 | ALDVGSGSGILTACFAR | PRIDE |