Annotation Detail for POLR2A
Basic Information Top
Gene Symbol: | POLR2A ( MGC75453,POLR2,POLRA,RPB1,RPBh1,RPO2,RPOL2,RpIILS,hRPB220,hsRPB1 ) |
---|---|
Gene Full Name: | polymerase (RNA) II (DNA directed) polypeptide A, 220kDa |
Band: | 17p13.1 |
Quick Links | Entrez ID:5430; OMIM: 180660; Uniprot ID:RPB1_HUMAN; ENSEMBL ID: ENSG00000181222; HGNC ID: 9187 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.270017
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 7 / 70761 | 98 | |
blastocyst | 4 / 62319 | 64 | |
fetus | 29 / 564012 | 51 | |
neonate | 5 / 31097 | 160 | |
infant | 0 / 23620 | 0 | |
juvenile | 6 / 55556 | 107 | |
adult | 289 / 1939121 | 149 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 2 / 17475 | 114 | |
breast (mammary gland) tumor | 43 / 94178 | 456 | |
cervical tumor | 2 / 34366 | 58 | |
chondrosarcoma | 6 / 82823 | 72 | |
colorectal tumor | 29 / 114246 | 253 | |
esophageal tumor | 1 / 17290 | 57 | |
gastrointestinal tumor | 11 / 119369 | 92 | |
germ cell tumor | 15 / 263845 | 56 | |
glioma | 8 / 106883 | 74 | |
head and neck tumor | 28 / 136302 | 205 | |
kidney tumor | 9 / 68959 | 130 | |
leukemia | 43 / 95842 | 448 | |
liver tumor | 6 / 96359 | 62 | |
lung tumor | 22 / 103127 | 213 | |
lymphoma | 2 / 71755 | 27 | |
non-neoplasia | 4 / 97250 | 41 | |
normal | 207 / 3360307 | 61 | |
ovarian tumor | 11 / 76682 | 143 | |
pancreatic tumor | 7 / 104616 | 66 | |
primitive neuroectodermal tumor of the CNS | 4 / 125680 | 31 | |
prostate cancer | 14 / 102680 | 136 | |
retinoblastoma | 4 / 46356 | 86 | |
skin tumor | 10 / 124949 | 80 | |
soft tissue/muscle tissue tumor | 10 / 125191 | 79 | |
uterine tumor | 6 / 90257 | 66 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 1 / 13106 | 76 | |
adrenal gland | 2 / 33197 | 60 | |
ascites | 0 / 40015 | 0 | |
bladder | 2 / 29757 | 67 | |
blood | 31 / 123478 | 251 | |
bone | 6 / 71655 | 83 | |
bone marrow | 11 / 48801 | 225 | |
brain | 47 / 1100989 | 42 | |
cervix | 2 / 48171 | 41 | |
connective tissue | 5 / 149255 | 33 | |
ear | 2 / 16212 | 123 | |
embryonic tissue | 16 / 215722 | 74 | |
esophagus | 1 / 20209 | 49 | |
eye | 19 / 211054 | 90 | |
heart | 1 / 89626 | 11 | |
intestine | 41 / 234472 | 174 | |
kidney | 13 / 211777 | 61 | |
larynx | 10 / 24145 | 414 | |
liver | 13 / 207743 | 62 | |
lung | 44 / 336974 | 130 | |
lymph | 2 / 44270 | 45 | |
lymph node | 11 / 91610 | 120 | |
mammary gland | 56 / 153271 | 365 | |
mouth | 13 / 67052 | 193 | |
muscle | 8 / 107715 | 74 | |
nerve | 0 / 15768 | 0 | |
ovary | 11 / 102051 | 107 | |
pancreas | 15 / 214812 | 69 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 2 / 16585 | 120 | |
placenta | 16 / 280825 | 56 | |
prostate | 24 / 189345 | 126 | |
salivary gland | 0 / 20155 | 0 | |
skin | 25 / 210574 | 118 | |
spleen | 2 / 53952 | 37 | |
stomach | 11 / 96619 | 113 | |
testis | 18 / 330442 | 54 | |
thymus | 8 / 81131 | 98 | |
thyroid | 10 / 47473 | 210 | |
tonsil | 0 / 16999 | 0 | |
trachea | 3 / 52413 | 57 | |
umbilical cord | 4 / 13680 | 292 | |
uterus | 13 / 232878 | 55 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 217420_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 8 | |
Adipocyte | 7.05 | |
AdrenalCortex | 9.7 | |
Adrenalgland | 6.65 | |
Amygdala | 7.2 | |
Appendix | 8.85 | |
AtrioventricularNode | 7.65 | |
BDCA4+_DentriticCells | 7.75 | |
Bonemarrow | 8.25 | |
BronchialEpithelialCells | 7.05 | |
CD105+_Endothelial | 7.35 | |
CD14+_Monocytes | 7.9 | |
CD19+_BCells(neg._sel.) | 7.5 | |
CD33+_Myeloid | 9.05 | |
CD34+ | 8.55 | |
CD4+_Tcells | 7.45 | |
CD56+_NKCells | 8.1 | |
CD71+_EarlyErythroid | 7.05 | |
CD8+_Tcells | 6.85 | |
CardiacMyocytes | 12.65 | |
Caudatenucleus | 6.5 | |
Cerebellum | 6.05 | |
CerebellumPeduncles | 9.1 | |
CiliaryGanglion | 6.55 | |
CingulateCortex | 7.75 | |
Colorectaladenocarcinoma | 7.4 | |
DorsalRootGanglion | 6.8 | |
FetalThyroid | 7.3 | |
Fetalbrain | 6.8 | |
Fetalliver | 6.45 | |
Fetallung | 5.45 | |
GlobusPallidus | 5.95 | |
Heart | 12.05 | |
Hypothalamus | 7.4 | |
Kidney | 6.6 | |
Leukemia_chronicMyelogenousK-562 | 6.5 | |
Leukemia_promyelocytic-HL-60 | 6.5 | |
Leukemialymphoblastic(MOLT-4) | 5.55 | |
Liver | 11.45 | |
Lung | 7.95 | |
Lymphnode | 5.9 | |
Lymphoma_burkitts(Daudi) | 9.75 | |
Lymphoma_burkitts(Raji) | 11.5 | |
MedullaOblongata | 6.6 | |
OccipitalLobe | 6.5 | |
OlfactoryBulb | 5.65 | |
Ovary | 5.5 | |
Pancreas | 6.2 | |
PancreaticIslet | 7.95 | |
ParietalLobe | 8.15 | |
Pituitary | 8.45 | |
Placenta | 7.1 | |
Pons | 7.35 | |
PrefrontalCortex | 8.45 | |
Prostate | 8.25 | |
Salivarygland | 6.25 | |
SkeletalMuscle | 11.1 | |
Skin | 6.85 | |
SmoothMuscle | 8.25 | |
Spinalcord | 7.6 | |
SubthalamicNucleus | 7.45 | |
SuperiorCervicalGanglion | 11.15 | |
TemporalLobe | 6.95 | |
Testis | 6.25 | |
TestisGermCell | 5.75 | |
TestisIntersitial | 6.3 | |
TestisLeydigCell | 7.65 | |
TestisSeminiferousTubule | 6.25 | |
Thalamus | 7.6 | |
Thymus | 5.55 | |
Thyroid | 8.7 | |
Tongue | 8.4 | |
Tonsil | 7.25 | |
Trachea | 6.05 | |
TrigeminalGanglion | 9.75 | |
Uterus | 5.7 | |
UterusCorpus | 7.9 | |
WholeBlood | 7.9 | |
Wholebrain | 5.75 | |
colon | 7.3 | |
pineal_day | 8.72 | |
pineal_night | 8.64 | |
retina | 8.8 | |
small_intestine | 6.85 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_24_P308128
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.72 ± 0.75 | |
Basal Forebrain | 3.45 ± 0.43 | |
Basal Part of Pons | 3.38 ± 0.39 | |
Cerebellar Cortex | 3.84 ± 0.53 | |
Cerebellar Nuclei | 3.76 ± 0.44 | |
Claustrum | 4.16 ± 0.66 | |
Epithalamus | 3.96 ± 0.5 | |
Frontal Lobe | 3.77 ± 0.53 | |
Globus Pallidus | 3.09 ± 0.72 | |
Hypothalamus | 3.26 ± 0.51 | |
Insula | 3.53 ± 0.47 | |
Limbic Lobe | 3.72 ± 0.53 | |
Mesencephalon | 3.8 ± 0.6 | |
Myelencephalon | 3.7 ± 0.58 | |
Occipital Lobe | 3.56 ± 0.65 | |
Parietal Lobe | 3.69 ± 0.62 | |
Pontine Tegmentum | 3.69 ± 0.59 | |
Striatum | 3.51 ± 0.63 | |
Subthalamus | 3.64 ± 0.7 | |
Temporal Lobe | 3.73 ± 0.51 | |
Thalamus | 3.53 ± 0.61 | |
White Matter | 4.73 ± 0.23 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Polr2a | CB | Cerebellum | 33.47 | |
41.56 | ||||
Polr2a | CTX | Cerebral cortex | 50.09 | |
39.73 | ||||
Polr2a | HIP | Hippocampal region | 41.06 | |
66.13 | ||||
Polr2a | HPF | Hippocampal formation | 45.2 | |
57.14 | ||||
Polr2a | HY | Hypothalamus | 17.02 | |
14.15 | ||||
Polr2a | LSX | Lateral septal complex | 25.74 | |
21.16 | ||||
Polr2a | MB | Midbrain | 20.58 | |
19.03 | ||||
Polr2a | MY | Medulla | 25.37 | |
29.94 | ||||
Polr2a | OLF | Olfactory bulb | 49.94 | |
44.62 | ||||
Polr2a | P | Pons | 25.58 | |
29.27 | ||||
Polr2a | PAL | Pallidum | 8.74 | |
7.72 | ||||
Polr2a | RHP | Retrohippocampal region | 51.43 | |
45.4 | ||||
Polr2a | sAMY | Striatum-like amygdalar nuclei | 17.22 | |
13.99 | ||||
Polr2a | STR | Striatum | 14.27 | |
11.6 | ||||
Polr2a | STRd | Striatum dorsal region | 14.97 | |
12.62 | ||||
Polr2a | STRv | Striatum ventral region | 5.27 | |
3.38 | ||||
Polr2a | TH | Thalamus | 32.83 | |
30.24 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00002936 | 30 | 150 | 179 | GKNICEGGEEMDNKFGVEQPEGDEDLTKEK | Peptide Atlas |
RPB1_HUMAN_262 | 10 | 262 | 271 | PAVVMQGSAR | PRIDE |
RPB1_HUMAN_309 | 19 | 309 | 327 | LLQFHVATMVDNELPGLPR | PRIDE |
RPB1_HUMAN_320 | 8 | 320 | 327 | NELPGLPR | PRIDE |
RPB1_HUMAN_383 | 19 | 383 | 401 | SIAANMTFAEIVTPFNIDR | PRIDE |