Annotation Detail for RETSAT
Basic Information Top
| Gene Symbol: | RETSAT ( FLJ20296 ) |
|---|---|
| Gene Full Name: | retinol saturase (all-trans-retinol 13,14-reductase) |
| Band: | 2p11.2 |
| Quick Links | Entrez ID:54884; OMIM: NA; Uniprot ID:RETST_HUMAN; ENSEMBL ID: ENSG00000042445; HGNC ID: 25991 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.440401
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 0 / 70761 | 0 | |
| blastocyst | 2 / 62319 | 32 | |
| fetus | 18 / 564012 | 31 | |
| neonate | 2 / 31097 | 64 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 6 / 55556 | 107 | |
| adult | 104 / 1939121 | 53 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 7 / 94178 | 74 | |
| cervical tumor | 6 / 34366 | 174 | |
| chondrosarcoma | 6 / 82823 | 72 | |
| colorectal tumor | 14 / 114246 | 122 | |
| esophageal tumor | 3 / 17290 | 173 | |
| gastrointestinal tumor | 10 / 119369 | 83 | |
| germ cell tumor | 12 / 263845 | 45 | |
| glioma | 2 / 106883 | 18 | |
| head and neck tumor | 41 / 136302 | 300 | |
| kidney tumor | 2 / 68959 | 29 | |
| leukemia | 1 / 95842 | 10 | |
| liver tumor | 5 / 96359 | 51 | |
| lung tumor | 2 / 103127 | 19 | |
| lymphoma | 7 / 71755 | 97 | |
| non-neoplasia | 18 / 97250 | 185 | |
| normal | 282 / 3360307 | 83 | |
| ovarian tumor | 8 / 76682 | 104 | |
| pancreatic tumor | 6 / 104616 | 57 | |
| primitive neuroectodermal tumor of the CNS | 10 / 125680 | 79 | |
| prostate cancer | 4 / 102680 | 38 | |
| retinoblastoma | 2 / 46356 | 43 | |
| skin tumor | 12 / 124949 | 96 | |
| soft tissue/muscle tissue tumor | 1 / 125191 | 7 | |
| uterine tumor | 5 / 90257 | 55 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 7 / 13106 | 534 | |
| adrenal gland | 7 / 33197 | 210 | |
| ascites | 7 / 40015 | 174 | |
| bladder | 1 / 29757 | 33 | |
| blood | 2 / 123478 | 16 | |
| bone | 3 / 71655 | 41 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 102 / 1100989 | 92 | |
| cervix | 6 / 48171 | 124 | |
| connective tissue | 17 / 149255 | 113 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 4 / 215722 | 18 | |
| esophagus | 4 / 20209 | 197 | |
| eye | 15 / 211054 | 71 | |
| heart | 3 / 89626 | 33 | |
| intestine | 40 / 234472 | 170 | |
| kidney | 38 / 211777 | 179 | |
| larynx | 0 / 24145 | 0 | |
| liver | 13 / 207743 | 62 | |
| lung | 12 / 336974 | 35 | |
| lymph | 2 / 44270 | 45 | |
| lymph node | 4 / 91610 | 43 | |
| mammary gland | 11 / 153271 | 71 | |
| mouth | 43 / 67052 | 641 | |
| muscle | 5 / 107715 | 46 | |
| nerve | 2 / 15768 | 126 | |
| ovary | 12 / 102051 | 117 | |
| pancreas | 9 / 214812 | 41 | |
| parathyroid | 1 / 20539 | 48 | |
| pharynx | 2 / 41328 | 48 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 12 / 280825 | 42 | |
| prostate | 21 / 189345 | 110 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 25 / 210574 | 118 | |
| spleen | 7 / 53952 | 129 | |
| stomach | 4 / 96619 | 41 | |
| testis | 50 / 330442 | 151 | |
| thymus | 15 / 81131 | 184 | |
| thyroid | 4 / 47473 | 84 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 12 / 52413 | 228 | |
| umbilical cord | 2 / 13680 | 146 | |
| uterus | 13 / 232878 | 55 | |
| vascular | 5 / 51780 | 96 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218124_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 28.6 | |
| Adipocyte | 191.95 | |
| AdrenalCortex | 16.05 | |
| Adrenalgland | 31.1 | |
| Amygdala | 16.6 | |
| Appendix | 13.95 | |
| AtrioventricularNode | 10.3 | |
| BDCA4+_DentriticCells | 31.4 | |
| Bonemarrow | 11.35 | |
| BronchialEpithelialCells | 33.7 | |
| CD105+_Endothelial | 12.6 | |
| CD14+_Monocytes | 16.45 | |
| CD19+_BCells(neg._sel.) | 12.75 | |
| CD33+_Myeloid | 17.35 | |
| CD34+ | 16.95 | |
| CD4+_Tcells | 23.3 | |
| CD56+_NKCells | 17.9 | |
| CD71+_EarlyErythroid | 10.4 | |
| CD8+_Tcells | 22.75 | |
| CardiacMyocytes | 16.9 | |
| Caudatenucleus | 12.15 | |
| Cerebellum | 10.55 | |
| CerebellumPeduncles | 13.8 | |
| CiliaryGanglion | 10.2 | |
| CingulateCortex | 13.2 | |
| Colorectaladenocarcinoma | 15.05 | |
| DorsalRootGanglion | 10.4 | |
| FetalThyroid | 16.95 | |
| Fetalbrain | 11.25 | |
| Fetalliver | 21.05 | |
| Fetallung | 10.6 | |
| GlobusPallidus | 9.95 | |
| Heart | 17.9 | |
| Hypothalamus | 23.45 | |
| Kidney | 19.1 | |
| Leukemia_chronicMyelogenousK-562 | 10.45 | |
| Leukemia_promyelocytic-HL-60 | 11.05 | |
| Leukemialymphoblastic(MOLT-4) | 10.8 | |
| Liver | 47.6 | |
| Lung | 26.7 | |
| Lymphnode | 11.8 | |
| Lymphoma_burkitts(Daudi) | 15 | |
| Lymphoma_burkitts(Raji) | 17.55 | |
| MedullaOblongata | 12.55 | |
| OccipitalLobe | 12.5 | |
| OlfactoryBulb | 10.8 | |
| Ovary | 8.2 | |
| Pancreas | 16.6 | |
| PancreaticIslet | 18 | |
| ParietalLobe | 13.65 | |
| Pituitary | 14.4 | |
| Placenta | 11.75 | |
| Pons | 13 | |
| PrefrontalCortex | 17.2 | |
| Prostate | 19.1 | |
| Salivarygland | 10.9 | |
| SkeletalMuscle | 15.8 | |
| Skin | 10.7 | |
| SmoothMuscle | 17.3 | |
| Spinalcord | 14.75 | |
| SubthalamicNucleus | 12.5 | |
| SuperiorCervicalGanglion | 14.85 | |
| TemporalLobe | 11.7 | |
| Testis | 12.35 | |
| TestisGermCell | 18.55 | |
| TestisIntersitial | 11.35 | |
| TestisLeydigCell | 13.55 | |
| TestisSeminiferousTubule | 11.6 | |
| Thalamus | 13.95 | |
| Thymus | 10.9 | |
| Thyroid | 83.5 | |
| Tongue | 17.2 | |
| Tonsil | 11.9 | |
| Trachea | 13.65 | |
| TrigeminalGanglion | 17.9 | |
| Uterus | 11.45 | |
| UterusCorpus | 10.8 | |
| WholeBlood | 13.55 | |
| Wholebrain | 22.15 | |
| colon | 119.1 | |
| pineal_day | 32.2 | |
| pineal_night | 30.38 | |
| retina | 29.475 | |
| small_intestine | 155.6 |
- Probe name: CUST_10902_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 4.54 ± 0.78 | |
| Basal Forebrain | 4.64 ± 0.74 | |
| Basal Part of Pons | 4.41 ± 0.59 | |
| Cerebellar Cortex | 4.49 ± 0.31 | |
| Cerebellar Nuclei | 4.61 ± 0.61 | |
| Claustrum | 4.58 ± 0.44 | |
| Epithalamus | 5.14 ± 0.34 | |
| Frontal Lobe | 4.65 ± 0.5 | |
| Globus Pallidus | 5.67 ± 0.37 | |
| Hypothalamus | 4.32 ± 0.48 | |
| Insula | 4.3 ± 0.5 | |
| Limbic Lobe | 4.59 ± 0.46 | |
| Mesencephalon | 4.79 ± 0.42 | |
| Myelencephalon | 4.69 ± 0.47 | |
| Occipital Lobe | 4.71 ± 0.49 | |
| Parietal Lobe | 4.56 ± 0.42 | |
| Pontine Tegmentum | 4.74 ± 0.51 | |
| Striatum | 4.71 ± 0.48 | |
| Subthalamus | 4.49 ± 0.45 | |
| Temporal Lobe | 4.57 ± 0.4 | |
| Thalamus | 4.79 ± 0.43 | |
| White Matter | 5.99 ± 0.26 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Retsat | CB | Cerebellum | 2.64 | |
| 3.6 | ||||
| Retsat | CTX | Cerebral cortex | 1.17 | |
| 1.29 | ||||
| Retsat | HIP | Hippocampal region | 3.49 | |
| 2.98 | ||||
| Retsat | HPF | Hippocampal formation | 4.33 | |
| 3.59 | ||||
| Retsat | HY | Hypothalamus | 4.27 | |
| 4.5 | ||||
| Retsat | LSX | Lateral septal complex | 0 | |
| 0 | ||||
| Retsat | MB | Midbrain | 4.65 | |
| 5.91 | ||||
| Retsat | MY | Medulla | 4.12 | |
| 5.75 | ||||
| Retsat | OLF | Olfactory bulb | 5.55 | |
| 4.36 | ||||
| Retsat | P | Pons | 7.3 | |
| 8.61 | ||||
| Retsat | PAL | Pallidum | 3.65 | |
| 2.91 | ||||
| Retsat | RHP | Retrohippocampal region | 6.13 | |
| 4.66 | ||||
| Retsat | sAMY | Striatum-like amygdalar nuclei | 4.71 | |
| 3.38 | ||||
| Retsat | STR | Striatum | 2.19 | |
| 1.77 | ||||
| Retsat | STRd | Striatum dorsal region | 0.75 | |
| 0.57 | ||||
| Retsat | STRv | Striatum ventral region | 6.45 | |
| 5.21 | ||||
| Retsat | TH | Thalamus | 3.22 | |
| 2.83 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00041125 | 32 | 338 | 369 | KGHELVNIYCPIVVSNAGLFNTYEHLLPGNAR | Peptide Atlas |



