Annotation Detail for LGMN
Basic Information Top
| Gene Symbol: | LGMN ( AEP,LGMN1,PRSC1 ) |
|---|---|
| Gene Full Name: | legumain |
| Band: | 14q32.12 |
| Quick Links | Entrez ID:5641; OMIM: 602620; Uniprot ID:LGMN_HUMAN; ENSEMBL ID: ENSG00000100600; HGNC ID: 9472 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.726036
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 4 / 70761 | 56 | |
| blastocyst | 8 / 62319 | 128 | |
| fetus | 77 / 564012 | 136 | |
| neonate | 188 / 31097 | 6045 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 13 / 55556 | 233 | |
| adult | 727 / 1939121 | 374 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 2 / 12794 | 156 | |
| bladder carcinoma | 1 / 17475 | 57 | |
| breast (mammary gland) tumor | 26 / 94178 | 276 | |
| cervical tumor | 4 / 34366 | 116 | |
| chondrosarcoma | 12 / 82823 | 144 | |
| colorectal tumor | 21 / 114246 | 183 | |
| esophageal tumor | 7 / 17290 | 404 | |
| gastrointestinal tumor | 65 / 119369 | 544 | |
| germ cell tumor | 25 / 263845 | 94 | |
| glioma | 16 / 106883 | 149 | |
| head and neck tumor | 17 / 136302 | 124 | |
| kidney tumor | 38 / 68959 | 551 | |
| leukemia | 3 / 95842 | 31 | |
| liver tumor | 15 / 96359 | 155 | |
| lung tumor | 5 / 103127 | 48 | |
| lymphoma | 1 / 71755 | 13 | |
| non-neoplasia | 119 / 97250 | 1223 | |
| normal | 1249 / 3360307 | 371 | |
| ovarian tumor | 9 / 76682 | 117 | |
| pancreatic tumor | 7 / 104616 | 66 | |
| primitive neuroectodermal tumor of the CNS | 23 / 125680 | 183 | |
| prostate cancer | 78 / 102680 | 759 | |
| retinoblastoma | 7 / 46356 | 151 | |
| skin tumor | 11 / 124949 | 88 | |
| soft tissue/muscle tissue tumor | 3 / 125191 | 23 | |
| uterine tumor | 18 / 90257 | 199 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 3 / 13106 | 228 | |
| adrenal gland | 7 / 33197 | 210 | |
| ascites | 34 / 40015 | 849 | |
| bladder | 8 / 29757 | 268 | |
| blood | 198 / 123478 | 1603 | |
| bone | 11 / 71655 | 153 | |
| bone marrow | 4 / 48801 | 81 | |
| brain | 120 / 1100989 | 108 | |
| cervix | 4 / 48171 | 83 | |
| connective tissue | 134 / 149255 | 897 | |
| ear | 5 / 16212 | 308 | |
| embryonic tissue | 16 / 215722 | 74 | |
| esophagus | 7 / 20209 | 346 | |
| eye | 23 / 211054 | 108 | |
| heart | 38 / 89626 | 423 | |
| intestine | 68 / 234472 | 290 | |
| kidney | 116 / 211777 | 547 | |
| larynx | 6 / 24145 | 248 | |
| liver | 33 / 207743 | 158 | |
| lung | 47 / 336974 | 139 | |
| lymph | 1 / 44270 | 22 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 35 / 153271 | 228 | |
| mouth | 6 / 67052 | 89 | |
| muscle | 3 / 107715 | 27 | |
| nerve | 2 / 15768 | 126 | |
| ovary | 14 / 102051 | 137 | |
| pancreas | 21 / 214812 | 97 | |
| parathyroid | 18 / 20539 | 876 | |
| pharynx | 2 / 41328 | 48 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 420 / 280825 | 1495 | |
| prostate | 90 / 189345 | 475 | |
| salivary gland | 1 / 20155 | 49 | |
| skin | 22 / 210574 | 104 | |
| spleen | 34 / 53952 | 630 | |
| stomach | 38 / 96619 | 393 | |
| testis | 39 / 330442 | 118 | |
| thymus | 44 / 81131 | 542 | |
| thyroid | 10 / 47473 | 210 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 9 / 52413 | 171 | |
| umbilical cord | 2 / 13680 | 146 | |
| uterus | 39 / 232878 | 167 | |
| vascular | 10 / 51780 | 193 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201212_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 99.25 | |
| Adipocyte | 21.7 | |
| AdrenalCortex | 12.35 | |
| Adrenalgland | 10.45 | |
| Amygdala | 35.7 | |
| Appendix | 13.4 | |
| AtrioventricularNode | 8.8 | |
| BDCA4+_DentriticCells | 62.6 | |
| Bonemarrow | 14.2 | |
| BronchialEpithelialCells | 10.05 | |
| CD105+_Endothelial | 12 | |
| CD14+_Monocytes | 9.45 | |
| CD19+_BCells(neg._sel.) | 9.4 | |
| CD33+_Myeloid | 10.9 | |
| CD34+ | 12.7 | |
| CD4+_Tcells | 9 | |
| CD56+_NKCells | 10.3 | |
| CD71+_EarlyErythroid | 8.1 | |
| CD8+_Tcells | 8.2 | |
| CardiacMyocytes | 20.7 | |
| Caudatenucleus | 9.2 | |
| Cerebellum | 8.65 | |
| CerebellumPeduncles | 13.2 | |
| CiliaryGanglion | 10.2 | |
| CingulateCortex | 11.15 | |
| Colorectaladenocarcinoma | 25.5 | |
| DorsalRootGanglion | 8.65 | |
| FetalThyroid | 15 | |
| Fetalbrain | 11.35 | |
| Fetalliver | 27.45 | |
| Fetallung | 15.5 | |
| GlobusPallidus | 7.7 | |
| Heart | 99.55 | |
| Hypothalamus | 14.05 | |
| Kidney | 100.95 | |
| Leukemia_chronicMyelogenousK-562 | 8.7 | |
| Leukemia_promyelocytic-HL-60 | 9.7 | |
| Leukemialymphoblastic(MOLT-4) | 18.05 | |
| Liver | 92.1 | |
| Lung | 189.65 | |
| Lymphnode | 71.7 | |
| Lymphoma_burkitts(Daudi) | 12.75 | |
| Lymphoma_burkitts(Raji) | 34.55 | |
| MedullaOblongata | 9.75 | |
| OccipitalLobe | 15.7 | |
| OlfactoryBulb | 7.4 | |
| Ovary | 9.15 | |
| Pancreas | 9.05 | |
| PancreaticIslet | 23.2 | |
| ParietalLobe | 11.8 | |
| Pituitary | 12.4 | |
| Placenta | 211.15 | |
| Pons | 14.8 | |
| PrefrontalCortex | 16.1 | |
| Prostate | 70.8 | |
| Salivarygland | 8.5 | |
| SkeletalMuscle | 13.8 | |
| Skin | 8.95 | |
| SmoothMuscle | 23.5 | |
| Spinalcord | 11.3 | |
| SubthalamicNucleus | 9.1 | |
| SuperiorCervicalGanglion | 15.45 | |
| TemporalLobe | 12.3 | |
| Testis | 13.25 | |
| TestisGermCell | 8.6 | |
| TestisIntersitial | 8.65 | |
| TestisLeydigCell | 12.15 | |
| TestisSeminiferousTubule | 11.4 | |
| Thalamus | 10.85 | |
| Thymus | 25.8 | |
| Thyroid | 182.15 | |
| Tongue | 13.3 | |
| Tonsil | 13.3 | |
| Trachea | 15.3 | |
| TrigeminalGanglion | 12.95 | |
| Uterus | 13.35 | |
| UterusCorpus | 10.45 | |
| WholeBlood | 9.8 | |
| Wholebrain | 39.95 | |
| colon | 42.95 | |
| pineal_day | 16.9 | |
| pineal_night | 18.6 | |
| retina | 55.8 | |
| small_intestine | 66 |
- Probe name: A_23_P25994
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 4.4 ± 0.66 | |
| Basal Forebrain | 3.92 ± 0.34 | |
| Basal Part of Pons | 4.77 ± 0.31 | |
| Cerebellar Cortex | 4.19 ± 0.58 | |
| Cerebellar Nuclei | 4.15 ± 0.78 | |
| Claustrum | 4.51 ± 0.58 | |
| Epithalamus | 4.23 ± 0.32 | |
| Frontal Lobe | 4.56 ± 0.5 | |
| Globus Pallidus | 3.79 ± 0.62 | |
| Hypothalamus | 4.49 ± 0.42 | |
| Insula | 4.63 ± 0.57 | |
| Limbic Lobe | 4.66 ± 0.45 | |
| Mesencephalon | 4.32 ± 0.55 | |
| Myelencephalon | 4.33 ± 0.55 | |
| Occipital Lobe | 4.09 ± 0.39 | |
| Parietal Lobe | 4.39 ± 0.44 | |
| Pontine Tegmentum | 4.38 ± 0.52 | |
| Striatum | 4.19 ± 0.56 | |
| Subthalamus | 4.28 ± 0.13 | |
| Temporal Lobe | 4.49 ± 0.47 | |
| Thalamus | 4.1 ± 0.56 | |
| White Matter | 4.41 ± 0.29 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| LGMN_HUMAN_101 | 17 | 101 | 117 | DYTGEDVTPQNFLAVLR | PRIDE |
| PAp00007139 | 30 | 135 | 164 | SGPQDHVFIYFTDHGSTGILVFPNEDLHVK | Peptide Atlas |




Mouse Brain ISH