Annotation Detail for LGMN


Gene Symbol: | LGMN ( AEP,LGMN1,PRSC1 ) |
---|---|
Gene Full Name: | legumain |
Band: | 14q32.12 |
Quick Links | Entrez ID:5641; OMIM: 602620; Uniprot ID:LGMN_HUMAN; ENSEMBL ID: ENSG00000100600; HGNC ID: 9472 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.726036
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 4 / 70761 | 56 | ![]() |
blastocyst | 8 / 62319 | 128 | ![]() |
fetus | 77 / 564012 | 136 | ![]() |
neonate | 188 / 31097 | 6045 | ![]() |
infant | 1 / 23620 | 42 | ![]() |
juvenile | 13 / 55556 | 233 | ![]() |
adult | 727 / 1939121 | 374 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 2 / 12794 | 156 | ![]() |
bladder carcinoma | 1 / 17475 | 57 | ![]() |
breast (mammary gland) tumor | 26 / 94178 | 276 | ![]() |
cervical tumor | 4 / 34366 | 116 | ![]() |
chondrosarcoma | 12 / 82823 | 144 | ![]() |
colorectal tumor | 21 / 114246 | 183 | ![]() |
esophageal tumor | 7 / 17290 | 404 | ![]() |
gastrointestinal tumor | 65 / 119369 | 544 | ![]() |
germ cell tumor | 25 / 263845 | 94 | ![]() |
glioma | 16 / 106883 | 149 | ![]() |
head and neck tumor | 17 / 136302 | 124 | ![]() |
kidney tumor | 38 / 68959 | 551 | ![]() |
leukemia | 3 / 95842 | 31 | ![]() |
liver tumor | 15 / 96359 | 155 | ![]() |
lung tumor | 5 / 103127 | 48 | ![]() |
lymphoma | 1 / 71755 | 13 | ![]() |
non-neoplasia | 119 / 97250 | 1223 | ![]() |
normal | 1249 / 3360307 | 371 | ![]() |
ovarian tumor | 9 / 76682 | 117 | ![]() |
pancreatic tumor | 7 / 104616 | 66 | ![]() |
primitive neuroectodermal tumor of the CNS | 23 / 125680 | 183 | ![]() |
prostate cancer | 78 / 102680 | 759 | ![]() |
retinoblastoma | 7 / 46356 | 151 | ![]() |
skin tumor | 11 / 124949 | 88 | ![]() |
soft tissue/muscle tissue tumor | 3 / 125191 | 23 | ![]() |
uterine tumor | 18 / 90257 | 199 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 3 / 13106 | 228 | ![]() |
adrenal gland | 7 / 33197 | 210 | ![]() |
ascites | 34 / 40015 | 849 | ![]() |
bladder | 8 / 29757 | 268 | ![]() |
blood | 198 / 123478 | 1603 | ![]() |
bone | 11 / 71655 | 153 | ![]() |
bone marrow | 4 / 48801 | 81 | ![]() |
brain | 120 / 1100989 | 108 | ![]() |
cervix | 4 / 48171 | 83 | ![]() |
connective tissue | 134 / 149255 | 897 | ![]() |
ear | 5 / 16212 | 308 | ![]() |
embryonic tissue | 16 / 215722 | 74 | ![]() |
esophagus | 7 / 20209 | 346 | ![]() |
eye | 23 / 211054 | 108 | ![]() |
heart | 38 / 89626 | 423 | ![]() |
intestine | 68 / 234472 | 290 | ![]() |
kidney | 116 / 211777 | 547 | ![]() |
larynx | 6 / 24145 | 248 | ![]() |
liver | 33 / 207743 | 158 | ![]() |
lung | 47 / 336974 | 139 | ![]() |
lymph | 1 / 44270 | 22 | ![]() |
lymph node | 0 / 91610 | 0 | |
mammary gland | 35 / 153271 | 228 | ![]() |
mouth | 6 / 67052 | 89 | ![]() |
muscle | 3 / 107715 | 27 | ![]() |
nerve | 2 / 15768 | 126 | ![]() |
ovary | 14 / 102051 | 137 | ![]() |
pancreas | 21 / 214812 | 97 | ![]() |
parathyroid | 18 / 20539 | 876 | ![]() |
pharynx | 2 / 41328 | 48 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 420 / 280825 | 1495 | ![]() |
prostate | 90 / 189345 | 475 | ![]() |
salivary gland | 1 / 20155 | 49 | ![]() |
skin | 22 / 210574 | 104 | ![]() |
spleen | 34 / 53952 | 630 | ![]() |
stomach | 38 / 96619 | 393 | ![]() |
testis | 39 / 330442 | 118 | ![]() |
thymus | 44 / 81131 | 542 | ![]() |
thyroid | 10 / 47473 | 210 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 9 / 52413 | 171 | ![]() |
umbilical cord | 2 / 13680 | 146 | ![]() |
uterus | 39 / 232878 | 167 | ![]() |
vascular | 10 / 51780 | 193 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201212_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 99.25 | ![]() |
Adipocyte | 21.7 | ![]() |
AdrenalCortex | 12.35 | ![]() |
Adrenalgland | 10.45 | ![]() |
Amygdala | 35.7 | ![]() |
Appendix | 13.4 | ![]() |
AtrioventricularNode | 8.8 | ![]() |
BDCA4+_DentriticCells | 62.6 | ![]() |
Bonemarrow | 14.2 | ![]() |
BronchialEpithelialCells | 10.05 | ![]() |
CD105+_Endothelial | 12 | ![]() |
CD14+_Monocytes | 9.45 | ![]() |
CD19+_BCells(neg._sel.) | 9.4 | ![]() |
CD33+_Myeloid | 10.9 | ![]() |
CD34+ | 12.7 | ![]() |
CD4+_Tcells | 9 | ![]() |
CD56+_NKCells | 10.3 | ![]() |
CD71+_EarlyErythroid | 8.1 | ![]() |
CD8+_Tcells | 8.2 | ![]() |
CardiacMyocytes | 20.7 | ![]() |
Caudatenucleus | 9.2 | ![]() |
Cerebellum | 8.65 | ![]() |
CerebellumPeduncles | 13.2 | ![]() |
CiliaryGanglion | 10.2 | ![]() |
CingulateCortex | 11.15 | ![]() |
Colorectaladenocarcinoma | 25.5 | ![]() |
DorsalRootGanglion | 8.65 | ![]() |
FetalThyroid | 15 | ![]() |
Fetalbrain | 11.35 | ![]() |
Fetalliver | 27.45 | ![]() |
Fetallung | 15.5 | ![]() |
GlobusPallidus | 7.7 | ![]() |
Heart | 99.55 | ![]() |
Hypothalamus | 14.05 | ![]() |
Kidney | 100.95 | ![]() |
Leukemia_chronicMyelogenousK-562 | 8.7 | ![]() |
Leukemia_promyelocytic-HL-60 | 9.7 | ![]() |
Leukemialymphoblastic(MOLT-4) | 18.05 | ![]() |
Liver | 92.1 | ![]() |
Lung | 189.65 | ![]() |
Lymphnode | 71.7 | ![]() |
Lymphoma_burkitts(Daudi) | 12.75 | ![]() |
Lymphoma_burkitts(Raji) | 34.55 | ![]() |
MedullaOblongata | 9.75 | ![]() |
OccipitalLobe | 15.7 | ![]() |
OlfactoryBulb | 7.4 | ![]() |
Ovary | 9.15 | ![]() |
Pancreas | 9.05 | ![]() |
PancreaticIslet | 23.2 | ![]() |
ParietalLobe | 11.8 | ![]() |
Pituitary | 12.4 | ![]() |
Placenta | 211.15 | ![]() |
Pons | 14.8 | ![]() |
PrefrontalCortex | 16.1 | ![]() |
Prostate | 70.8 | ![]() |
Salivarygland | 8.5 | ![]() |
SkeletalMuscle | 13.8 | ![]() |
Skin | 8.95 | ![]() |
SmoothMuscle | 23.5 | ![]() |
Spinalcord | 11.3 | ![]() |
SubthalamicNucleus | 9.1 | ![]() |
SuperiorCervicalGanglion | 15.45 | ![]() |
TemporalLobe | 12.3 | ![]() |
Testis | 13.25 | ![]() |
TestisGermCell | 8.6 | ![]() |
TestisIntersitial | 8.65 | ![]() |
TestisLeydigCell | 12.15 | ![]() |
TestisSeminiferousTubule | 11.4 | ![]() |
Thalamus | 10.85 | ![]() |
Thymus | 25.8 | ![]() |
Thyroid | 182.15 | ![]() |
Tongue | 13.3 | ![]() |
Tonsil | 13.3 | ![]() |
Trachea | 15.3 | ![]() |
TrigeminalGanglion | 12.95 | ![]() |
Uterus | 13.35 | ![]() |
UterusCorpus | 10.45 | ![]() |
WholeBlood | 9.8 | ![]() |
Wholebrain | 39.95 | ![]() |
colon | 42.95 | ![]() |
pineal_day | 16.9 | ![]() |
pineal_night | 18.6 | ![]() |
retina | 55.8 | ![]() |
small_intestine | 66 | ![]() |
- Probe name: A_23_P25994
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 4.4 ± 0.66 | ![]() ![]() ![]() |
Basal Forebrain | 3.92 ± 0.34 | ![]() ![]() ![]() |
Basal Part of Pons | 4.77 ± 0.31 | ![]() ![]() ![]() |
Cerebellar Cortex | 4.19 ± 0.58 | ![]() ![]() ![]() |
Cerebellar Nuclei | 4.15 ± 0.78 | ![]() ![]() ![]() |
Claustrum | 4.51 ± 0.58 | ![]() ![]() ![]() |
Epithalamus | 4.23 ± 0.32 | ![]() ![]() ![]() |
Frontal Lobe | 4.56 ± 0.5 | ![]() ![]() ![]() |
Globus Pallidus | 3.79 ± 0.62 | ![]() ![]() ![]() |
Hypothalamus | 4.49 ± 0.42 | ![]() ![]() ![]() |
Insula | 4.63 ± 0.57 | ![]() ![]() ![]() |
Limbic Lobe | 4.66 ± 0.45 | ![]() ![]() ![]() |
Mesencephalon | 4.32 ± 0.55 | ![]() ![]() ![]() |
Myelencephalon | 4.33 ± 0.55 | ![]() ![]() ![]() |
Occipital Lobe | 4.09 ± 0.39 | ![]() ![]() ![]() |
Parietal Lobe | 4.39 ± 0.44 | ![]() ![]() ![]() |
Pontine Tegmentum | 4.38 ± 0.52 | ![]() ![]() ![]() |
Striatum | 4.19 ± 0.56 | ![]() ![]() ![]() |
Subthalamus | 4.28 ± 0.13 | ![]() ![]() ![]() |
Temporal Lobe | 4.49 ± 0.47 | ![]() ![]() ![]() |
Thalamus | 4.1 ± 0.56 | ![]() ![]() ![]() |
White Matter | 4.41 ± 0.29 | ![]() ![]() ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
LGMN_HUMAN_101 | 17 | 101 | 117 | DYTGEDVTPQNFLAVLR | PRIDE |
PAp00007139 | 30 | 135 | 164 | SGPQDHVFIYFTDHGSTGILVFPNEDLHVK | Peptide Atlas |