Annotation Detail for RTN4
Basic Information Top
| Gene Symbol: | RTN4 ( ASY,NI220/250,NOGO,NOGO-A,NOGOC,NSP,NSP-CL,Nbla00271,Nbla10545,Nogo-B,Nogo-C,RTN-X,RTN4-A,RTN4-B1,RTN4-B2,RTN4-C ) |
|---|---|
| Gene Full Name: | reticulon 4 |
| Band: | 2p16.1 |
| Quick Links | Entrez ID:57142; OMIM: 604475; Uniprot ID:RTN4_HUMAN; ENSEMBL ID: ENSG00000115310; HGNC ID: 14085 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.727710
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 3 / 70761 | 42 | |
| blastocyst | 2 / 62319 | 32 | |
| fetus | 4 / 564012 | 7 | |
| neonate | 2 / 31097 | 64 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 4 / 55556 | 71 | |
| adult | 12 / 1939121 | 6 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 1 / 94178 | 10 | |
| cervical tumor | 1 / 34366 | 29 | |
| chondrosarcoma | 1 / 82823 | 12 | |
| colorectal tumor | 0 / 114246 | 0 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 2 / 119369 | 16 | |
| germ cell tumor | 5 / 263845 | 18 | |
| glioma | 0 / 106883 | 0 | |
| head and neck tumor | 0 / 136302 | 0 | |
| kidney tumor | 1 / 68959 | 14 | |
| leukemia | 1 / 95842 | 10 | |
| liver tumor | 3 / 96359 | 31 | |
| lung tumor | 0 / 103127 | 0 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 2 / 97250 | 20 | |
| normal | 52 / 3360307 | 15 | |
| ovarian tumor | 0 / 76682 | 0 | |
| pancreatic tumor | 4 / 104616 | 38 | |
| primitive neuroectodermal tumor of the CNS | 4 / 125680 | 31 | |
| prostate cancer | 0 / 102680 | 0 | |
| retinoblastoma | 2 / 46356 | 43 | |
| skin tumor | 4 / 124949 | 32 | |
| soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
| uterine tumor | 0 / 90257 | 0 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 1 / 33197 | 30 | |
| ascites | 1 / 40015 | 24 | |
| bladder | 0 / 29757 | 0 | |
| blood | 2 / 123478 | 16 | |
| bone | 1 / 71655 | 13 | |
| bone marrow | 0 / 48801 | 0 | |
| brain | 18 / 1100989 | 16 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 3 / 149255 | 20 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 10 / 215722 | 46 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 4 / 211054 | 18 | |
| heart | 0 / 89626 | 0 | |
| intestine | 0 / 234472 | 0 | |
| kidney | 4 / 211777 | 18 | |
| larynx | 0 / 24145 | 0 | |
| liver | 3 / 207743 | 14 | |
| lung | 3 / 336974 | 8 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 1 / 91610 | 10 | |
| mammary gland | 1 / 153271 | 6 | |
| mouth | 0 / 67052 | 0 | |
| muscle | 0 / 107715 | 0 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 0 / 102051 | 0 | |
| pancreas | 4 / 214812 | 18 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 1 / 280825 | 3 | |
| prostate | 0 / 189345 | 0 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 13 / 210574 | 61 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 1 / 96619 | 10 | |
| testis | 3 / 330442 | 9 | |
| thymus | 0 / 81131 | 0 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 1 / 52413 | 19 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 0 / 232878 | 0 | |
| vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 211509_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 1360.75 | |
| Adipocyte | 4212 | |
| AdrenalCortex | 1098.6 | |
| Adrenalgland | 1738.3 | |
| Amygdala | 12922.4 | |
| Appendix | 551.35 | |
| AtrioventricularNode | 286.8 | |
| BDCA4+_DentriticCells | 1212.55 | |
| Bonemarrow | 586.6 | |
| BronchialEpithelialCells | 2182.55 | |
| CD105+_Endothelial | 1045 | |
| CD14+_Monocytes | 1862.85 | |
| CD19+_BCells(neg._sel.) | 639.65 | |
| CD33+_Myeloid | 2249.45 | |
| CD34+ | 1177.5 | |
| CD4+_Tcells | 683.5 | |
| CD56+_NKCells | 1363.45 | |
| CD71+_EarlyErythroid | 315.5 | |
| CD8+_Tcells | 753.05 | |
| CardiacMyocytes | 3048.85 | |
| Caudatenucleus | 4675.05 | |
| Cerebellum | 1568.25 | |
| CerebellumPeduncles | 1817.85 | |
| CiliaryGanglion | 971.85 | |
| CingulateCortex | 4506.3 | |
| Colorectaladenocarcinoma | 1180.2 | |
| DorsalRootGanglion | 987.45 | |
| FetalThyroid | 759.4 | |
| Fetalbrain | 4203.9 | |
| Fetalliver | 627.8 | |
| Fetallung | 1231.85 | |
| GlobusPallidus | 3696.25 | |
| Heart | 170.1 | |
| Hypothalamus | 5261.6 | |
| Kidney | 1294.55 | |
| Leukemia_chronicMyelogenousK-562 | 1909.55 | |
| Leukemia_promyelocytic-HL-60 | 700.5 | |
| Leukemialymphoblastic(MOLT-4) | 1116.75 | |
| Liver | 133.2 | |
| Lung | 1396.7 | |
| Lymphnode | 676.8 | |
| Lymphoma_burkitts(Daudi) | 356.3 | |
| Lymphoma_burkitts(Raji) | 957.35 | |
| MedullaOblongata | 4411.85 | |
| OccipitalLobe | 6890.15 | |
| OlfactoryBulb | 1607.95 | |
| Ovary | 472.35 | |
| Pancreas | 488.75 | |
| PancreaticIslet | 1224.35 | |
| ParietalLobe | 6341.5 | |
| Pituitary | 1156.9 | |
| Placenta | 1569.1 | |
| Pons | 3271.6 | |
| PrefrontalCortex | 6936.95 | |
| Prostate | 2327.35 | |
| Salivarygland | 742.45 | |
| SkeletalMuscle | 798.5 | |
| Skin | 750.05 | |
| SmoothMuscle | 4316.8 | |
| Spinalcord | 4791.45 | |
| SubthalamicNucleus | 4248.2 | |
| SuperiorCervicalGanglion | 312.25 | |
| TemporalLobe | 3213.7 | |
| Testis | 476.1 | |
| TestisGermCell | 920.4 | |
| TestisIntersitial | 871.7 | |
| TestisLeydigCell | 735.25 | |
| TestisSeminiferousTubule | 472 | |
| Thalamus | 3683 | |
| Thymus | 558.75 | |
| Thyroid | 3154.85 | |
| Tongue | 1506.45 | |
| Tonsil | 443.85 | |
| Trachea | 1023.7 | |
| TrigeminalGanglion | 705 | |
| Uterus | 1522.9 | |
| UterusCorpus | 575.15 | |
| WholeBlood | 1818.6 | |
| Wholebrain | 4228.35 | |
| colon | 1933.3 | |
| pineal_day | 5944.7 | |
| pineal_night | 5963.62 | |
| retina | 4159.45 | |
| small_intestine | 2084.1 |
- Probe name: CUST_13436_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 11.06 ± 0.47 | |
| Basal Forebrain | 10.79 ± 0.39 | |
| Basal Part of Pons | 10.99 ± 0.44 | |
| Cerebellar Cortex | 10.27 ± 0.22 | |
| Cerebellar Nuclei | 10.27 ± 0.44 | |
| Claustrum | 10.56 ± 0.22 | |
| Epithalamus | 10.13 ± 0.4 | |
| Frontal Lobe | 10.44 ± 0.37 | |
| Globus Pallidus | 9.65 ± 0.49 | |
| Hypothalamus | 10.35 ± 0.66 | |
| Insula | 10.35 ± 0.35 | |
| Limbic Lobe | 10.47 ± 0.53 | |
| Mesencephalon | 10.58 ± 0.54 | |
| Myelencephalon | 10.56 ± 0.51 | |
| Occipital Lobe | 11.17 ± 0.48 | |
| Parietal Lobe | 10.7 ± 0.33 | |
| Pontine Tegmentum | 10.6 ± 0.35 | |
| Striatum | 11.42 ± 0.36 | |
| Subthalamus | 10.59 ± 0.19 | |
| Temporal Lobe | 10.67 ± 0.3 | |
| Thalamus | 10.69 ± 0.33 | |
| White Matter | 8.73 ± 0.49 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Rtn4 | CB | Cerebellum | 63.45 | |
| 100 | ||||
| Rtn4 | CTX | Cerebral cortex | 100 | |
| 100 | ||||
| Rtn4 | HIP | Hippocampal region | 100 | |
| 100 | ||||
| Rtn4 | HPF | Hippocampal formation | 100 | |
| 100 | ||||
| Rtn4 | HY | Hypothalamus | 100 | |
| 100 | ||||
| Rtn4 | LSX | Lateral septal complex | 100 | |
| 100 | ||||
| Rtn4 | MB | Midbrain | 100 | |
| 100 | ||||
| Rtn4 | MY | Medulla | 100 | |
| 100 | ||||
| Rtn4 | OLF | Olfactory bulb | 100 | |
| 100 | ||||
| Rtn4 | P | Pons | 100 | |
| 100 | ||||
| Rtn4 | PAL | Pallidum | 100 | |
| 100 | ||||
| Rtn4 | RHP | Retrohippocampal region | 100 | |
| 100 | ||||
| Rtn4 | sAMY | Striatum-like amygdalar nuclei | 100 | |
| 100 | ||||
| Rtn4 | STR | Striatum | 100 | |
| 100 | ||||
| Rtn4 | STRd | Striatum dorsal region | 100 | |
| 100 | ||||
| Rtn4 | STRv | Striatum ventral region | 100 | |
| 100 | ||||
| Rtn4 | TH | Thalamus | 100 | |
| 100 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00003494 | 14 | 339 | 352 | HQAQIDHYLGLANK | Peptide Atlas |
| RTN4_HUMAN_0 | 0 | 0 | 0 | GPLPAAPPVAPER | PRIDE |
| RTN4_HUMAN_0 | 0 | 0 | 0 | HQAQIDHYLGLANK | PRIDE |
| RTN4_HUMAN_0 | 0 | 0 | 0 | YSNSALGHVNCTIK | PRIDE |
| RTN4_HUMAN_1 | 24 | 1 | 24 | MEDLDQSPLVSSSDSPPRPQPAFK | PRIDE |
| RTN4_HUMAN_1074 | 16 | 1074 | 1089 | AYLESEVAISEELVQK | PRIDE |
| RTN4_HUMAN_1090 | 14 | 1090 | 1103 | YSNSALGHVNCTIK | PRIDE |
| RTN4_HUMAN_1157 | 14 | 1157 | 1170 | HQAQIDHYLGLANK | PRIDE |
| RTN4_HUMAN_57 | 34 | 57 | 90 | KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR | PRIDE |
| RTN4_HUMAN_65 | 27 | 65 | 91 | AAPVPTAPAAGAPLMDFGNDFVPPAPR | PRIDE |
| RTN4_HUMAN_91 | 13 | 91 | 103 | GPLPAAPPVAPER | PRIDE |
| RTN4_HUMAN_92 | 13 | 92 | 104 | GPLPAAPPVAPER | PRIDE |
| RTN4_HUMAN_94 | 11 | 94 | 104 | LPAAPPVAPER | PRIDE |



