Annotation Detail for RTN4


Gene Symbol: | RTN4 ( ASY,NI220/250,NOGO,NOGO-A,NOGOC,NSP,NSP-CL,Nbla00271,Nbla10545,Nogo-B,Nogo-C,RTN-X,RTN4-A,RTN4-B1,RTN4-B2,RTN4-C ) |
---|---|
Gene Full Name: | reticulon 4 |
Band: | 2p16.1 |
Quick Links | Entrez ID:57142; OMIM: 604475; Uniprot ID:RTN4_HUMAN; ENSEMBL ID: ENSG00000115310; HGNC ID: 14085 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.727710
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 3 / 70761 | 42 | ![]() |
blastocyst | 2 / 62319 | 32 | ![]() |
fetus | 4 / 564012 | 7 | ![]() |
neonate | 2 / 31097 | 64 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 4 / 55556 | 71 | ![]() |
adult | 12 / 1939121 | 6 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | ![]() |
cervical tumor | 1 / 34366 | 29 | ![]() |
chondrosarcoma | 1 / 82823 | 12 | ![]() |
colorectal tumor | 0 / 114246 | 0 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 2 / 119369 | 16 | ![]() |
germ cell tumor | 5 / 263845 | 18 | ![]() |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 1 / 68959 | 14 | ![]() |
leukemia | 1 / 95842 | 10 | ![]() |
liver tumor | 3 / 96359 | 31 | ![]() |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 2 / 97250 | 20 | ![]() |
normal | 52 / 3360307 | 15 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 4 / 104616 | 38 | ![]() |
primitive neuroectodermal tumor of the CNS | 4 / 125680 | 31 | ![]() |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 2 / 46356 | 43 | ![]() |
skin tumor | 4 / 124949 | 32 | ![]() |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 1 / 33197 | 30 | ![]() |
ascites | 1 / 40015 | 24 | ![]() |
bladder | 0 / 29757 | 0 | |
blood | 2 / 123478 | 16 | ![]() |
bone | 1 / 71655 | 13 | ![]() |
bone marrow | 0 / 48801 | 0 | |
brain | 18 / 1100989 | 16 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 3 / 149255 | 20 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 10 / 215722 | 46 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 4 / 211054 | 18 | ![]() |
heart | 0 / 89626 | 0 | |
intestine | 0 / 234472 | 0 | |
kidney | 4 / 211777 | 18 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 3 / 207743 | 14 | ![]() |
lung | 3 / 336974 | 8 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 1 / 91610 | 10 | ![]() |
mammary gland | 1 / 153271 | 6 | ![]() |
mouth | 0 / 67052 | 0 | |
muscle | 0 / 107715 | 0 | |
nerve | 1 / 15768 | 63 | ![]() |
ovary | 0 / 102051 | 0 | |
pancreas | 4 / 214812 | 18 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 1 / 280825 | 3 | ![]() |
prostate | 0 / 189345 | 0 | |
salivary gland | 0 / 20155 | 0 | |
skin | 13 / 210574 | 61 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 1 / 96619 | 10 | ![]() |
testis | 3 / 330442 | 9 | ![]() |
thymus | 0 / 81131 | 0 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 1 / 52413 | 19 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 0 / 232878 | 0 | |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 211509_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 1360.75 | ![]() |
Adipocyte | 4212 | ![]() |
AdrenalCortex | 1098.6 | ![]() |
Adrenalgland | 1738.3 | ![]() |
Amygdala | 12922.4 | ![]() |
Appendix | 551.35 | ![]() |
AtrioventricularNode | 286.8 | ![]() |
BDCA4+_DentriticCells | 1212.55 | ![]() |
Bonemarrow | 586.6 | ![]() |
BronchialEpithelialCells | 2182.55 | ![]() |
CD105+_Endothelial | 1045 | ![]() |
CD14+_Monocytes | 1862.85 | ![]() |
CD19+_BCells(neg._sel.) | 639.65 | ![]() |
CD33+_Myeloid | 2249.45 | ![]() |
CD34+ | 1177.5 | ![]() |
CD4+_Tcells | 683.5 | ![]() |
CD56+_NKCells | 1363.45 | ![]() |
CD71+_EarlyErythroid | 315.5 | ![]() |
CD8+_Tcells | 753.05 | ![]() |
CardiacMyocytes | 3048.85 | ![]() |
Caudatenucleus | 4675.05 | ![]() |
Cerebellum | 1568.25 | ![]() |
CerebellumPeduncles | 1817.85 | ![]() |
CiliaryGanglion | 971.85 | ![]() |
CingulateCortex | 4506.3 | ![]() |
Colorectaladenocarcinoma | 1180.2 | ![]() |
DorsalRootGanglion | 987.45 | ![]() |
FetalThyroid | 759.4 | ![]() |
Fetalbrain | 4203.9 | ![]() |
Fetalliver | 627.8 | ![]() |
Fetallung | 1231.85 | ![]() |
GlobusPallidus | 3696.25 | ![]() |
Heart | 170.1 | ![]() |
Hypothalamus | 5261.6 | ![]() |
Kidney | 1294.55 | ![]() |
Leukemia_chronicMyelogenousK-562 | 1909.55 | ![]() |
Leukemia_promyelocytic-HL-60 | 700.5 | ![]() |
Leukemialymphoblastic(MOLT-4) | 1116.75 | ![]() |
Liver | 133.2 | ![]() |
Lung | 1396.7 | ![]() |
Lymphnode | 676.8 | ![]() |
Lymphoma_burkitts(Daudi) | 356.3 | ![]() |
Lymphoma_burkitts(Raji) | 957.35 | ![]() |
MedullaOblongata | 4411.85 | ![]() |
OccipitalLobe | 6890.15 | ![]() |
OlfactoryBulb | 1607.95 | ![]() |
Ovary | 472.35 | ![]() |
Pancreas | 488.75 | ![]() |
PancreaticIslet | 1224.35 | ![]() |
ParietalLobe | 6341.5 | ![]() |
Pituitary | 1156.9 | ![]() |
Placenta | 1569.1 | ![]() |
Pons | 3271.6 | ![]() |
PrefrontalCortex | 6936.95 | ![]() |
Prostate | 2327.35 | ![]() |
Salivarygland | 742.45 | ![]() |
SkeletalMuscle | 798.5 | ![]() |
Skin | 750.05 | ![]() |
SmoothMuscle | 4316.8 | ![]() |
Spinalcord | 4791.45 | ![]() |
SubthalamicNucleus | 4248.2 | ![]() |
SuperiorCervicalGanglion | 312.25 | ![]() |
TemporalLobe | 3213.7 | ![]() |
Testis | 476.1 | ![]() |
TestisGermCell | 920.4 | ![]() |
TestisIntersitial | 871.7 | ![]() |
TestisLeydigCell | 735.25 | ![]() |
TestisSeminiferousTubule | 472 | ![]() |
Thalamus | 3683 | ![]() |
Thymus | 558.75 | ![]() |
Thyroid | 3154.85 | ![]() |
Tongue | 1506.45 | ![]() |
Tonsil | 443.85 | ![]() |
Trachea | 1023.7 | ![]() |
TrigeminalGanglion | 705 | ![]() |
Uterus | 1522.9 | ![]() |
UterusCorpus | 575.15 | ![]() |
WholeBlood | 1818.6 | ![]() |
Wholebrain | 4228.35 | ![]() |
colon | 1933.3 | ![]() |
pineal_day | 5944.7 | ![]() |
pineal_night | 5963.62 | ![]() |
retina | 4159.45 | ![]() |
small_intestine | 2084.1 | ![]() |
- Probe name: CUST_13436_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 11.06 ± 0.47 | ![]() ![]() ![]() |
Basal Forebrain | 10.79 ± 0.39 | ![]() ![]() ![]() |
Basal Part of Pons | 10.99 ± 0.44 | ![]() ![]() ![]() |
Cerebellar Cortex | 10.27 ± 0.22 | ![]() ![]() ![]() |
Cerebellar Nuclei | 10.27 ± 0.44 | ![]() ![]() ![]() |
Claustrum | 10.56 ± 0.22 | ![]() ![]() ![]() |
Epithalamus | 10.13 ± 0.4 | ![]() ![]() ![]() |
Frontal Lobe | 10.44 ± 0.37 | ![]() ![]() ![]() |
Globus Pallidus | 9.65 ± 0.49 | ![]() ![]() ![]() |
Hypothalamus | 10.35 ± 0.66 | ![]() ![]() ![]() |
Insula | 10.35 ± 0.35 | ![]() ![]() ![]() |
Limbic Lobe | 10.47 ± 0.53 | ![]() ![]() ![]() |
Mesencephalon | 10.58 ± 0.54 | ![]() ![]() ![]() |
Myelencephalon | 10.56 ± 0.51 | ![]() ![]() ![]() |
Occipital Lobe | 11.17 ± 0.48 | ![]() ![]() ![]() |
Parietal Lobe | 10.7 ± 0.33 | ![]() ![]() ![]() |
Pontine Tegmentum | 10.6 ± 0.35 | ![]() ![]() ![]() |
Striatum | 11.42 ± 0.36 | ![]() ![]() ![]() |
Subthalamus | 10.59 ± 0.19 | ![]() ![]() ![]() |
Temporal Lobe | 10.67 ± 0.3 | ![]() ![]() ![]() |
Thalamus | 10.69 ± 0.33 | ![]() ![]() ![]() |
White Matter | 8.73 ± 0.49 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Rtn4 | CB | Cerebellum | 63.45 | ![]() |
100 | ![]() | |||
Rtn4 | CTX | Cerebral cortex | 100 | ![]() |
100 | ![]() | |||
Rtn4 | HIP | Hippocampal region | 100 | ![]() |
100 | ![]() | |||
Rtn4 | HPF | Hippocampal formation | 100 | ![]() |
100 | ![]() | |||
Rtn4 | HY | Hypothalamus | 100 | ![]() |
100 | ![]() | |||
Rtn4 | LSX | Lateral septal complex | 100 | ![]() |
100 | ![]() | |||
Rtn4 | MB | Midbrain | 100 | ![]() |
100 | ![]() | |||
Rtn4 | MY | Medulla | 100 | ![]() |
100 | ![]() | |||
Rtn4 | OLF | Olfactory bulb | 100 | ![]() |
100 | ![]() | |||
Rtn4 | P | Pons | 100 | ![]() |
100 | ![]() | |||
Rtn4 | PAL | Pallidum | 100 | ![]() |
100 | ![]() | |||
Rtn4 | RHP | Retrohippocampal region | 100 | ![]() |
100 | ![]() | |||
Rtn4 | sAMY | Striatum-like amygdalar nuclei | 100 | ![]() |
100 | ![]() | |||
Rtn4 | STR | Striatum | 100 | ![]() |
100 | ![]() | |||
Rtn4 | STRd | Striatum dorsal region | 100 | ![]() |
100 | ![]() | |||
Rtn4 | STRv | Striatum ventral region | 100 | ![]() |
100 | ![]() | |||
Rtn4 | TH | Thalamus | 100 | ![]() |
100 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00003494 | 14 | 339 | 352 | HQAQIDHYLGLANK | Peptide Atlas |
RTN4_HUMAN_0 | 0 | 0 | 0 | GPLPAAPPVAPER | PRIDE |
RTN4_HUMAN_0 | 0 | 0 | 0 | HQAQIDHYLGLANK | PRIDE |
RTN4_HUMAN_0 | 0 | 0 | 0 | YSNSALGHVNCTIK | PRIDE |
RTN4_HUMAN_1 | 24 | 1 | 24 | MEDLDQSPLVSSSDSPPRPQPAFK | PRIDE |
RTN4_HUMAN_1074 | 16 | 1074 | 1089 | AYLESEVAISEELVQK | PRIDE |
RTN4_HUMAN_1090 | 14 | 1090 | 1103 | YSNSALGHVNCTIK | PRIDE |
RTN4_HUMAN_1157 | 14 | 1157 | 1170 | HQAQIDHYLGLANK | PRIDE |
RTN4_HUMAN_57 | 34 | 57 | 90 | KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR | PRIDE |
RTN4_HUMAN_65 | 27 | 65 | 91 | AAPVPTAPAAGAPLMDFGNDFVPPAPR | PRIDE |
RTN4_HUMAN_91 | 13 | 91 | 103 | GPLPAAPPVAPER | PRIDE |
RTN4_HUMAN_92 | 13 | 92 | 104 | GPLPAAPPVAPER | PRIDE |
RTN4_HUMAN_94 | 11 | 94 | 104 | LPAAPPVAPER | PRIDE |