Annotation Detail for ZDBF2
Basic Information Top
Gene Symbol: | ZDBF2 ( FLJ45338,KIAA1571 ) |
---|---|
Gene Full Name: | zinc finger, DBF-type containing 2 |
Band: | 2q33.3 |
Quick Links | Entrez ID:57683; OMIM: NA; Uniprot ID:ZDBF2_HUMAN; ENSEMBL ID: ENSG00000204186; HGNC ID: 29313 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.110489
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 1 / 70761 | 14 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 4 / 564012 | 7 | |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 25 / 1939121 | 12 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 1 / 114246 | 8 | |
esophageal tumor | 1 / 17290 | 57 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 3 / 263845 | 11 | |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 1 / 103127 | 9 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 1 / 97250 | 10 | |
normal | 35 / 3360307 | 10 | |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 1 / 90257 | 11 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 3 / 33197 | 90 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 0 / 123478 | 0 | |
bone | 1 / 71655 | 13 | |
bone marrow | 0 / 48801 | 0 | |
brain | 6 / 1100989 | 5 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 0 / 149255 | 0 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 2 / 215722 | 9 | |
esophagus | 1 / 20209 | 49 | |
eye | 1 / 211054 | 4 | |
heart | 0 / 89626 | 0 | |
intestine | 1 / 234472 | 4 | |
kidney | 0 / 211777 | 0 | |
larynx | 0 / 24145 | 0 | |
liver | 3 / 207743 | 14 | |
lung | 1 / 336974 | 2 | |
lymph | 0 / 44270 | 0 | |
lymph node | 2 / 91610 | 21 | |
mammary gland | 0 / 153271 | 0 | |
mouth | 0 / 67052 | 0 | |
muscle | 3 / 107715 | 27 | |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 1 / 214812 | 4 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 9 / 280825 | 32 | |
prostate | 0 / 189345 | 0 | |
salivary gland | 0 / 20155 | 0 | |
skin | 0 / 210574 | 0 | |
spleen | 0 / 53952 | 0 | |
stomach | 0 / 96619 | 0 | |
testis | 5 / 330442 | 15 | |
thymus | 0 / 81131 | 0 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 1 / 52413 | 19 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 1 / 232878 | 4 | |
vascular | 1 / 51780 | 19 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_32_P68504
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 7.41 ± 0.7 | |
Basal Forebrain | 7.66 ± 0.27 | |
Basal Part of Pons | 7.4 ± 0.49 | |
Cerebellar Cortex | 7.45 ± 0.19 | |
Cerebellar Nuclei | 6.82 ± 0.47 | |
Claustrum | 7.13 ± 0.56 | |
Epithalamus | 7.21 ± 0.33 | |
Frontal Lobe | 7.29 ± 0.38 | |
Globus Pallidus | 6.13 ± 0.38 | |
Hypothalamus | 8.06 ± 0.32 | |
Insula | 7.57 ± 0.25 | |
Limbic Lobe | 7.33 ± 0.5 | |
Mesencephalon | 7.25 ± 0.64 | |
Myelencephalon | 7.3 ± 0.53 | |
Occipital Lobe | 7.43 ± 0.45 | |
Parietal Lobe | 7.32 ± 0.46 | |
Pontine Tegmentum | 7.3 ± 0.51 | |
Striatum | 7.62 ± 0.57 | |
Subthalamus | 7.05 ± 0.95 | |
Temporal Lobe | 7.38 ± 0.35 | |
Thalamus | 7.11 ± 0.35 | |
White Matter | 5.1 ± 0.33 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
4930431J08Rik | CB | Cerebellum | 3.13 | |
3.89 | ||||
4930431J08Rik | CTX | Cerebral cortex | 22.17 | |
19 | ||||
4930431J08Rik | HIP | Hippocampal region | 13.27 | |
17.03 | ||||
4930431J08Rik | HPF | Hippocampal formation | 17.9 | |
19.52 | ||||
4930431J08Rik | HY | Hypothalamus | 54.77 | |
57.77 | ||||
4930431J08Rik | LSX | Lateral septal complex | 70.07 | |
71.5 | ||||
4930431J08Rik | MB | Midbrain | 18.83 | |
20.42 | ||||
4930431J08Rik | MY | Medulla | 17.1 | |
19.95 | ||||
4930431J08Rik | OLF | Olfactory bulb | 20.13 | |
18.16 | ||||
4930431J08Rik | P | Pons | 25.38 | |
29.47 | ||||
4930431J08Rik | PAL | Pallidum | 33.74 | |
36.84 | ||||
4930431J08Rik | RHP | Retrohippocampal region | 26.33 | |
23.89 | ||||
4930431J08Rik | sAMY | Striatum-like amygdalar nuclei | 69.49 | |
68.07 | ||||
4930431J08Rik | STR | Striatum | 32.11 | |
29.13 | ||||
4930431J08Rik | STRd | Striatum dorsal region | 17.35 | |
14.04 | ||||
4930431J08Rik | STRv | Striatum ventral region | 42.7 | |
36.68 | ||||
4930431J08Rik | TH | Thalamus | 13.28 | |
15.08 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00500309 | 16 | 329 | 344 | NHEEFFSNMDCTQEEK | Peptide Atlas |
ZDBF2_HUMAN_1932 | 19 | 1932 | 1950 | VASQCQTAKISHSTQTSCK | PRIDE |
ZDBF2_HUMAN_2080 | 33 | 2080 | 2112 | IHFNRSNQNSSAGDNDADGQGSASAPLMAVPAR | PRIDE |